Recombinant Pyrus pyrifolia Chlorophyll a-b binding protein 1A, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein 1A, chloroplastic; LHCII type II CAB-1A; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-278
Protein Length
Full Length of Mature Protein
Species
Pyrus pyrifolia (Chinese pear) (Pyrus serotina)
Target Protein Sequence
RKATGRKSVAASIDSPWYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLI HAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVK EIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary role of Chlorophyll a-b binding protein 1A in Pyrus pyrifolia photosynthesis?

Chlorophyll a-b binding protein 1A in Pyrus pyrifolia functions as a crucial component of the Light-Harvesting Complex II (LHCII) in chloroplast thylakoid membranes. Similar to Lhcb1 proteins in other plant species, it binds both chlorophyll a and b molecules to facilitate light energy capture and transfer to photosynthetic reaction centers. Research with model plants has demonstrated that Lhcb1 is particularly important for the formation of LHCII trimers and grana stacking in thylakoid membranes . Plants deficient in Lhcb1 show reduced chlorophyll content (approximately 30% reduction) and an increased chlorophyll a/b ratio of around 4, compared to the wild-type ratio of 3.2 . This suggests that in Pyrus pyrifolia, Chlorophyll a-b binding protein 1A plays an essential role in maintaining optimal thylakoid structure and photosynthetic efficiency.

When designing experiments to investigate this protein's function, researchers should consider comparative analyses between wild-type and protein-deficient plants, focusing on parameters such as chlorophyll content, photosynthetic efficiency, and thylakoid ultrastructure.

How can researchers effectively express and purify recombinant Pyrus pyrifolia Chlorophyll a-b binding protein 1A?

The expression and purification of recombinant Chlorophyll a-b binding proteins present unique challenges due to their hydrophobic nature and association with pigments. Based on established protocols for similar proteins, a methodological approach should include:

  • Gene cloning: Isolate the gene encoding Chlorophyll a-b binding protein 1A from Pyrus pyrifolia and clone it into an appropriate expression vector with a purification tag (His-tag recommended).

  • Expression system selection: Consider both prokaryotic (E. coli) and eukaryotic (insect cells) systems, with eukaryotic systems often providing better folding for membrane proteins. For E. coli expression, use specialized strains designed for membrane protein expression and inclusion body refolding protocols.

  • Membrane protein extraction: Employ mild detergents such as β-DM (n-dodecyl β-D-maltoside) or digitonin, which have been successfully used to solubilize thylakoid membranes while preserving protein complexes and their interactions .

  • Purification strategy: Implement a multi-step purification process:

    • Affinity chromatography using the fusion tag

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography for final purification and buffer exchange

  • Functional verification: Confirm protein integrity through spectroscopic analysis, as functional chlorophyll-binding proteins display characteristic absorption and fluorescence spectra, and verify complex formation through Blue Native PAGE analysis .

The successful expression and purification of this protein enable numerous downstream structural and functional studies essential for understanding its role in photosynthesis.

How does Pyrus pyrifolia Chlorophyll a-b binding protein 1A contribute to thylakoid membrane organization?

The contribution of Chlorophyll a-b binding protein 1A to thylakoid membrane organization can be inferred from research on homologous proteins in other plants. Electron microscopy studies have revealed that Lhcb1 plays a critical role in grana stacking and membrane reorganization during state transitions . Quantitative analysis has shown that plants lacking Lhcb1 have significantly fewer grana and stacked layers (4.38 ± 0.10) compared to wild-type plants (5.65 ± 0.28) .

Additionally, while wild-type plants demonstrate thylakoid structural flexibility in response to different light qualities, Lhcb1-deficient plants fail to show this adaptability . This indicates that Chlorophyll a-b binding protein 1A likely serves both structural and dynamic roles in the thylakoid membranes of Pyrus pyrifolia chloroplasts.

Table 1: Comparison of thylakoid structural parameters in wild-type and Lhcb-deficient plants

ParameterWild-typeLhcb1-deficientLhcb2-deficient
Grana layers (State 1)5.65 ± 0.284.38 ± 0.105.19 ± 0.14
Grana layers (State 2)4.22 ± 0.104.09 ± 0.104.20 ± 0.11
Structural flexibilityPresentAbsentPresent

To investigate this aspect in Pyrus pyrifolia, researchers should employ:

  • Transmission electron microscopy with quantitative analysis of grana dimensions

  • Blue Native PAGE to analyze pigment-protein complex composition under different conditions

  • Dynamic studies using fluorescence recovery after photobleaching (FRAP)

  • Comparative analyses between wild-type and transgenic plants with modified expression of the target protein

What protein complexes incorporate Pyrus pyrifolia Chlorophyll a-b binding protein 1A, and how can they be characterized?

Chlorophyll a-b binding protein 1A is likely incorporated into several protein complexes within the thylakoid membrane, primarily as a component of LHCII trimers and various PSII supercomplexes. Based on studies of similar proteins, these complexes can be characterized using a combination of biochemical and biophysical techniques.

Blue Native PAGE analysis of thylakoid membranes solubilized with mild detergents (β-DM or digitonin) can resolve these complexes according to their native size and composition. Research with Lhcb1-deficient plants has shown distinct differences in complex formation compared to wild-type plants, with no visible LHCII trimers and an absence of megacomplexes in the mutants . Additionally, the distribution of other LHCII proteins (Lhcb2 and Lhcb3) was significantly altered in the absence of Lhcb1, with Lhcb3 being unable to form homotrimers .

For Pyrus pyrifolia Chlorophyll a-b binding protein 1A, researchers should investigate:

  • The composition and stability of LHCII trimers

  • The integration of these trimers into larger PSII supercomplexes

  • The dynamic association with PSI complexes during state transitions

  • The stoichiometry of different Lhcb proteins within the complexes

Complex characterization methodologies should include:

  • Blue Native PAGE combined with immunoblotting using specific antibodies

  • Mass spectrometry analysis of isolated complexes

  • Single-particle cryo-electron microscopy for structural determination

  • Cross-linking studies to identify protein-protein interaction interfaces

What role does Pyrus pyrifolia Chlorophyll a-b binding protein 1A play in photoprotection mechanisms?

Chlorophyll a-b binding proteins are involved in photoprotection mechanisms that help plants dissipate excess light energy and prevent photooxidative damage. Research has demonstrated that Lhcb1 plays a crucial role in the qE type of non-photochemical quenching (NPQ) , which rapidly dissipates excess excitation energy as heat.

Studies with model plants have shown that specimens lacking Lhcb1 exhibited decreased qE quenching compared to wild-type plants, while plants deficient in Lhcb2 displayed normal qE levels . This indicates that Lhcb1, but not Lhcb2, is specifically required for efficient qE. The reduced capacity for qE in Lhcb1-deficient plants appears to be a direct consequence of fewer quenching sites rather than an indirect effect, as evidenced by experiments with double mutants lacking both Lhcb1 and PsbS (a protein essential for NPQ) .

For Pyrus pyrifolia, this suggests that Chlorophyll a-b binding protein 1A likely plays a vital role in photoprotection, particularly under high light conditions typical in orchard settings. Methodological approaches to study this aspect include:

  • Pulse-amplitude modulated (PAM) fluorometry to measure NPQ kinetics and capacity

  • Analysis of xanthophyll cycle activity under various light intensities

  • Measurement of reactive oxygen species production under photoinhibitory conditions

  • Time-resolved spectroscopy to monitor energy dissipation pathways

  • Comparative analysis between wild-type and transgenic lines with altered expression levels

How do environmental factors and developmental stages affect the expression of Chlorophyll a-b binding protein 1A in Pyrus pyrifolia?

The expression of Chlorophyll a-b binding protein 1A likely varies in response to environmental conditions and developmental stages to optimize photosynthetic performance. While specific data for Pyrus pyrifolia is limited, research with model plants and other crop species provides valuable insights.

Plants lacking Lhcb1 show compromised growth under fluctuating light conditions . When subjected to alternating low-light (50 μmol photons m^-2 s^-1) and high-light peaks (500 μmol photons m^-2 s^-1), Lhcb1-deficient plants exhibited significantly stunted growth (142.55 ± 19.34 mg) compared to wild-type plants (386.43 ± 37.49 mg) . This suggests that in Pyrus pyrifolia, Chlorophyll a-b binding protein 1A expression is likely critical for adapting to the variable light conditions typical in orchard environments.

Research with pear leaves has also shown that treatments affecting chlorophyll biosynthesis can influence the expression of genes involved in the chlorophyll biosynthetic pathway . For example, treatment with 5-aminolevulinic acid (ALA) significantly altered the expression of multiple genes related to chlorophyll synthesis, with different temporal patterns of up- and down-regulation .

To investigate the regulation of Chlorophyll a-b binding protein 1A expression in Pyrus pyrifolia, researchers should consider:

  • Transcriptomic analysis across different developmental stages (young leaves, mature leaves, senescent leaves)

  • qRT-PCR quantification of gene expression under various environmental conditions (light intensity, temperature, drought)

  • Promoter analysis to identify regulatory elements responsive to environmental cues

  • Epigenetic studies to explore potential DNA methylation or histone modification patterns

  • Correlation studies between protein abundance and chlorophyll content/composition

How can researchers effectively analyze the excitonic interactions in Pyrus pyrifolia Chlorophyll a-b binding protein 1A?

Excitonic interactions between chlorophyll molecules bound to light-harvesting proteins significantly influence the efficiency of light energy capture and transfer. While specific data for Pyrus pyrifolia is not available, studies of related proteins provide valuable insights into these processes and applicable methodologies.

Research on chlorophyll-binding proteins has revealed that chlorophyll dimers within these proteins exhibit excitonic coupling, with interaction energies (V) ranging from 66-108 cm^-1 depending on the specific protein and chlorophyll type . These interactions create excitonic states with energy gaps of approximately 200 cm^-1 for chlorophyll a and 130 cm^-1 for chlorophyll b complexes .

For analyzing excitonic interactions in Pyrus pyrifolia Chlorophyll a-b binding protein 1A, researchers should employ a multi-technique approach:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to detect excitonic coupling between pigments

    • Absorption spectroscopy with Gaussian deconvolution to identify individual excitonic states

    • Low-temperature fluorescence spectroscopy to resolve emission from different energy states

    • Transient absorption spectroscopy to track energy transfer pathways

  • Structural approaches:

    • X-ray crystallography or cryo-electron microscopy to determine pigment orientations

    • Molecular dynamics simulations to model dynamic aspects of pigment-protein interactions

  • Quantitative analysis:

    • Calculation of interaction energies based on the transition dipole moments of chlorophylls

    • Modeling of excitonic states using quantum mechanical approaches

    • Correlation of spectroscopic data with structural parameters

Understanding these excitonic properties is crucial for elucidating the fundamental mechanisms of light harvesting in Pyrus pyrifolia and may provide insights for the design of artificial photosynthetic systems.

What approaches are most effective for studying the role of Pyrus pyrifolia Chlorophyll a-b binding protein 1A in state transitions?

State transitions represent a short-term adaptation mechanism that balances excitation energy between photosystems by relocating light-harvesting complexes. Research has shown that both Lhcb1 and Lhcb2 are necessary for functional state transitions, with neither being sufficient alone . When investigating the role of Pyrus pyrifolia Chlorophyll a-b binding protein 1A in this process, researchers should implement a comprehensive methodological framework:

  • Experimental design considerations:

    • Light treatments to induce different states (red light for state 2, far-red plus red light for state 1)

    • Time-course experiments capturing the transition dynamics (typically minutes)

    • Control conditions including kinase inhibitors to block phosphorylation-dependent processes

  • Analytical techniques:

    • Low-temperature (77K) fluorescence spectroscopy to monitor changes in PSI/PSII fluorescence ratios

    • Pulse-amplitude modulated chlorophyll fluorescence to measure real-time PSII efficiency changes

    • Blue Native PAGE combined with immunoblotting to detect formation of PSI-LHCII complexes

    • Phosphoproteomic analysis to quantify LHCII phosphorylation levels

  • Genetic approaches:

    • RNAi or CRISPR-based knockdown/knockout of the gene encoding Chlorophyll a-b binding protein 1A

    • Complementation studies with wild-type or mutated proteins

    • Introduction of phosphorylation site mutations to test the role of specific residues

Table 2: Comparative analysis of state transition measurements in wild-type and Lhcb-deficient plants

ParameterWild-typeLhcb1-deficientLhcb2-deficient
PSI-LHCII complex formationPresentAbsentAbsent
Change in PSI/PSII fluorescence ratioSignificantNegligibleNegligible
PSII fluorescence decline (t1/2)~2 minNot observed>30 min

Studies in model plants have shown that specimens lacking either Lhcb1 or Lhcb2 fail to demonstrate light quality-dependent changes in photosystem fluorescence, indicating impaired state transitions . This suggests that Pyrus pyrifolia Chlorophyll a-b binding protein 1A likely plays an essential role in this adaptive process.

How do abiotic stresses affect the function and stability of Pyrus pyrifolia Chlorophyll a-b binding protein 1A?

Abiotic stresses, including temperature extremes, drought, and high light, can significantly impact the function and stability of photosynthetic proteins. While specific data for Pyrus pyrifolia Chlorophyll a-b binding protein 1A is limited, research with related proteins provides valuable insights into potential stress responses and methodological approaches for investigation.

Under high light stress, plants lacking Lhcb1 show compromised non-photochemical quenching (qE) and increased reduction of the plastoquinone pool . This indicates impaired photoprotection mechanisms. Additionally, under fluctuating light conditions, plants deficient in both Lhcb1 and Lhcb2 exhibit severely stunted growth compared to wild-type plants , suggesting reduced adaptive capacity.

For investigating abiotic stress responses in Pyrus pyrifolia, researchers should consider:

  • Stress treatment protocols:

    • Controlled environment experiments with precisely defined stress parameters

    • Field trials under natural variable conditions

    • Combined stress treatments to mimic realistic environmental challenges

  • Analytical approaches:

    • Quantification of protein abundance and turnover rates under stress

    • Analysis of post-translational modifications induced by stress conditions

    • Assessment of protein complex stability using native electrophoresis

    • Measurement of photosynthetic parameters under stress conditions

    • Monitoring of reactive oxygen species production and oxidative damage

  • Potential mechanisms to investigate:

    • Changes in protein phosphorylation status affecting protein-protein interactions

    • Alterations in thylakoid membrane lipid composition influencing protein stability

    • Stress-induced proteolytic degradation pathways

    • Transcriptional regulation of gene expression under stress conditions

Understanding the stress responses of Pyrus pyrifolia Chlorophyll a-b binding protein 1A would provide valuable insights for developing stress-tolerant pear varieties with improved photosynthetic efficiency under suboptimal conditions.

What methodological approaches can be used to engineer improved versions of Pyrus pyrifolia Chlorophyll a-b binding protein 1A for enhanced photosynthetic efficiency?

Engineering improved versions of Chlorophyll a-b binding protein 1A represents an advanced research direction with potential agricultural applications. Based on current understanding of these proteins, several methodological approaches can be considered:

  • Targeted mutagenesis strategies:

    • Modification of phosphorylation sites to alter state transition dynamics

    • Engineering of pigment-binding pockets to optimize excitonic coupling

    • Alteration of protein-protein interaction interfaces to enhance complex stability

    • Introduction of amino acids that stabilize the protein under stress conditions

  • Experimental approaches:

    • Site-directed mutagenesis of recombinant proteins

    • In vitro reconstitution with pigments to assess binding properties

    • Spectroscopic characterization of engineered variants

    • Transformation of model plants for in vivo functional testing

  • Screening and selection methods:

    • High-throughput spectroscopic assays to identify variants with superior properties

    • Chlorophyll fluorescence imaging to assess photosynthetic performance

    • Growth assays under challenging conditions to evaluate stress resilience

    • Metabolomic analysis to determine effects on downstream carbon fixation

  • Advanced technologies:

    • Directed evolution approaches to generate and screen protein variants

    • Computational protein design based on structural insights

    • CRISPR-based precision genome editing for implementation in Pyrus pyrifolia

When designing improved versions, researchers should focus on enhancing specific properties such as photoprotection capacity, stability under stress conditions, or optimized excitonic coupling for more efficient light harvesting, while maintaining the protein's essential structural role in thylakoid organization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.