Recombinant Quaternary ammonium compound-resistance protein qacE (qacE)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

qacE has been heterologously expressed in Escherichia coli for functional studies. Key parameters include:

ParameterDetailsSource
Expression VectorPlasmid-based systems (e.g., pET-28a) with inducible promoters (e.g., T7/lac)
TaggingN-terminal His-tag for purification via immobilized metal affinity chromatography (IMAC)
Purification Yield>90% purity confirmed by SDS-PAGE; molecular weight ~12 kDa
Activity ValidationFluorimetric assays confirming ethidium bromide and benzalkonium chloride efflux

Recombinant qacE retains resistance profiles similar to native forms, including MIC increases of 4–8× for QACs like cetrimide .

Substrate Specificity

qacE effluxes a narrower range of substrates compared to other Qac proteins:

SubstrateResistance LevelComparison to QacA/QacBSource
Ethidium bromideHighSimilar to QacC
Benzalkonium chlorideModerateLower than QacG/QacH
ChlorhexidineNoneUnlike QacA

Mechanism of Action

  • Energy Dependency: Efflux driven by proton motive force .

  • Co-resistance: Frequently linked to antibiotic resistance genes (e.g., blaNDM-1, sul1) in class 1 integrons .

Applications in Research

  • Antiseptic Resistance Modeling: Used to study biocide tolerance in nosocomial pathogens like Acinetobacter baumannii .

  • Efflux Pump Inhibitor Screening: Target for developing adjuvants to restore QAC efficacy .

Epidemiological Significance

PathogenqacE PrevalenceAssociated Resistance TraitsSource
Klebsiella pneumoniae34%Carbapenemases (NDM-1), aminoglycoside-modifying enzymes
Pseudomonas aeruginosa22%Extended-spectrum β-lactamases (ESBLs)

Challenges and Future Directions

  • Misannotation Issues: qacE is often mislabeled as qacEΔ1 (a truncated variant lacking 16 C-terminal residues) .

  • Evolutionary Dynamics: Horizontal gene transfer via integrons accelerates spread in clinical settings .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to customer requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
qacE; Quaternary ammonium compound-resistance protein QacE; Quaternary ammonium determinant E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Escherichia coli
Target Names
qacE
Target Protein Sequence
MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIVSGVVVLNLLSKASAH
Uniprot No.

Target Background

Function

Function: Multidrug exporter implicated in resistance to bactericidal quaternary ammonium compounds.

Protein Families
Small multidrug resistance (SMR) protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Quaternary ammonium compound-resistance protein qacE and what is its significance in antimicrobial resistance studies?

Quaternary ammonium compound-resistance protein qacE is a membrane protein that confers resistance to quaternary ammonium compounds (QACs) through efflux mechanisms. The protein functions as part of the small multidrug resistance (SMR) family and is encoded by the qacE gene, which is often found on mobile genetic elements such as integrons and plasmids. The significance of qacE lies in its contribution to bacterial resistance against antiseptics and disinfectants commonly used in healthcare and industrial settings. From a research perspective, studying qacE provides valuable insights into horizontal gene transfer mechanisms and the evolution of antimicrobial resistance. The protein's presence across diverse bacterial species makes it an important target for understanding the dissemination of resistance genes in clinical and environmental settings .

What experimental design principles should be considered when studying qacE expression?

When designing experiments to study qacE expression, researchers should follow systematic experimental design principles with clearly defined hypotheses. Begin by specifying the responses to examine (e.g., gene expression levels, protein activity, minimum inhibitory concentrations) and identify treatment factors (e.g., exposure to different QAC concentrations, growth conditions, presence of other resistance genes). Determine appropriate values for these treatment factors and establish fixed values for all other parameters to ensure experimental control .

The experimental framework should include:

  • Specific hypotheses about how treatment factors affect responses

  • Adequate number of replicates for statistical validity

  • Appropriate controls (positive, negative, and experimental)

  • Clear stopping criteria

  • Consistent methods for random number generation if applicable

  • Standardized protocols for measuring gene expression or protein activity

This structured approach minimizes inefficiencies and ensures that results can be properly analyzed and interpreted. Additionally, consider using factorial designs to examine potential interactions between factors affecting qacE expression .

How can recombinant qacE protein be effectively expressed and purified for functional studies?

Effective expression and purification of recombinant qacE protein requires careful consideration of expression systems and purification protocols due to its membrane-associated nature. The recommended methodological approach includes:

Expression System Selection:

  • Bacterial systems (E. coli BL21(DE3) or C43(DE3)) for standard expression

  • Cell-free systems for potentially toxic membrane proteins

  • Yeast or mammalian cells for complex post-translational modifications

Expression Protocol:

  • Clone the qacE gene into an expression vector with an appropriate tag (His6, FLAG, or GST)

  • Transform into the chosen expression strain

  • Induce expression at lower temperatures (16-18°C) to enhance proper folding

  • Consider using specialized media formulations to enhance membrane protein expression

Purification Methodology:

  • Harvest cells and lyse using methods preserving membrane protein integrity

  • Solubilize membrane fraction using detergents (n-dodecyl-β-D-maltoside or CHAPS)

  • Perform affinity chromatography using the introduced tag

  • Apply size exclusion chromatography for final purification

Quality Control:

  • Assess protein purity via SDS-PAGE and Western blotting

  • Confirm integrity through circular dichroism or thermal shift assays

  • Verify functionality through binding or transport assays

This systematic approach ensures the production of functional recombinant qacE protein suitable for downstream applications while minimizing aggregation and misfolding issues common with membrane proteins .

How can researchers effectively analyze contradictory data regarding qacE functionality in different bacterial hosts?

When confronted with contradictory data regarding qacE functionality across different bacterial hosts, researchers should implement a systematic analytical framework. Begin by evaluating the experimental conditions under which the contradictory results were obtained, particularly focusing on differences in bacterial host backgrounds, expression systems, and experimental methodologies .

Implement the following analytical approach:

  • Cross-validation with multiple methodologies: Employ both phenotypic assays (MIC determinations, efflux assays) and molecular approaches (protein expression levels, localization studies) to verify observations.

  • Correlation analysis: Analyze the correlation between qacE expression levels and resistance phenotypes across different hosts to identify potential host-specific factors influencing protein function.

  • Systematic context evaluation: Examine the genetic context of qacE (presence of adjacent genes, integron location) in different hosts that may influence its expression or function.

  • Computational modeling: Apply structural prediction and molecular dynamics to identify potential host-specific interactions that may affect qacE functionality.

What are the most effective experimental approaches for investigating the structural determinants of qacE substrate specificity?

Investigating the structural determinants of qacE substrate specificity requires a multi-faceted experimental approach combining molecular, biochemical, and computational techniques. The following methodological framework is recommended:

Site-Directed Mutagenesis Studies:

  • Identify conserved residues through multiple sequence alignment with related proteins

  • Generate systematic alanine scanning mutants of transmembrane domains

  • Create targeted mutations based on computational predictions

  • Evaluate each mutant for altered substrate profiles using transport assays

Substrate Binding Analysis:

  • Develop binding assays using purified qacE protein and fluorescently labeled substrates

  • Perform competition binding assays with various QACs to determine relative affinities

  • Conduct isothermal titration calorimetry to measure binding thermodynamics

  • Use surface plasmon resonance for real-time binding kinetics

Structural Studies:

  • Attempt crystallization of qacE with and without bound substrates

  • Apply cryo-electron microscopy for structural determination

  • Implement hydrogen-deuterium exchange mass spectrometry to map conformational changes upon substrate binding

Computational Approaches:

  • Perform molecular docking simulations with diverse QAC substrates

  • Conduct molecular dynamics simulations to evaluate substrate-protein interactions

  • Use machine learning to identify patterns in substrate recognition

This integrated approach enables researchers to correlate specific structural elements with substrate recognition and transport efficiency. By systematically testing multiple hypotheses and combining experimental data with computational modeling, researchers can develop a comprehensive understanding of the molecular basis for qacE substrate specificity .

How can qacE resistance mechanisms be differentiated from other efflux-mediated resistance systems in complex bacterial communities?

Differentiating qacE-specific resistance mechanisms from other efflux systems in complex bacterial communities requires specialized methodological approaches that combine genetic, functional, and computational techniques. The following systematic framework is recommended:

Genetic Profiling:

TechniqueApplicationAdvantageLimitation
Targeted PCRDetection of qacE and qacEΔ1 genesRapid screening of samplesLimited to known variants
Whole genome sequencingComprehensive genetic context analysisCaptures all resistance determinantsResource intensive for community samples
MetagenomicsCommunity-wide resistance gene profilingProvides population-level insightsMay miss low-abundance genes
RNA-SeqExpression analysis of resistance genesIdentifies actively transcribed genesRequires high-quality RNA from complex samples

Functional Characterization:

  • Develop qacE-specific inhibitors to selectively block its activity while monitoring effects on resistance profiles

  • Create reporter systems using qacE promoters fused to fluorescent proteins to track expression in situ

  • Implement competitive fitness assays with and without QAC selection pressure to evaluate qacE contribution

Computational Discrimination:

  • Apply machine learning algorithms to differentiate resistance patterns characteristic of qacE from other efflux systems

  • Develop network analysis to identify co-occurrence patterns of qacE with other resistance determinants

  • Implement statistical models that account for the confounding effects of multiple resistance mechanisms

Community-Based Approaches:

  • Use stable isotope probing combined with qacE-specific detection to link activity to specific community members

  • Apply flow cytometry sorting with fluorescent antibodies against qacE for single-cell analysis

  • Implement CRISPR-Cas-based techniques for targeted depletion of qacE to assess its specific contribution

What are the key considerations for designing experiments to assess qacE expression under different environmental conditions?

When designing experiments to assess qacE expression under varying environmental conditions, researchers must implement a structured experimental framework that accounts for multiple variables and potential interactions. The following methodological considerations are critical:

Experimental Design Framework:

  • Clearly define response variables (e.g., mRNA levels, protein expression, phenotypic resistance)

  • Select treatment factors with biological relevance (pH, temperature, nutrient availability, stress conditions)

  • Determine appropriate factor levels based on environmental relevance

  • Design factorial experiments to capture interaction effects between factors

  • Include adequate biological and technical replicates (minimum n=3 for each condition)

Controls and Standardization:

  • Include appropriate positive controls (known inducers of qacE)

  • Implement negative controls (strains lacking qacE)

  • Maintain consistent baseline conditions across experiments

  • Standardize growth phases for sampling to minimize variability

  • Consider using common random numbers for simulated components to reduce variability

Measurement Methodologies:

  • For gene expression: RT-qPCR with validated reference genes specific to the conditions being tested

  • For protein levels: Western blotting with appropriate loading controls or quantitative proteomics

  • For functional assessment: Standardized MIC determinations or efflux assays

Data Analysis Approaches:

  • Apply appropriate statistical methods based on experimental design (ANOVA, mixed models)

  • Include power analysis to ensure adequate sample sizes

  • Implement correlation analyses between expression levels and functional outcomes

  • Consider modeling approaches to predict expression under untested conditions

By systematically addressing these considerations, researchers can develop robust experimental designs that yield reliable and interpretable data on qacE expression across environmental conditions. This approach minimizes confounding variables while maximizing the informational content of the results .

How should researchers approach the development of high-throughput screening assays for identifying novel compounds that interact with qacE?

Developing high-throughput screening (HTS) assays for identifying novel compounds that interact with qacE requires a methodical approach that balances throughput, sensitivity, and biological relevance. The following framework provides a structured methodology:

Assay Development Strategy:

  • Target-Based Primary Screens:

    • Develop fluorescence-based binding assays using purified recombinant qacE

    • Implement thermal shift assays to detect ligand-induced protein stabilization

    • Create FRET-based assays to monitor conformational changes upon binding

  • Functional Secondary Screens:

    • Establish transport assays using qacE-expressing bacterial or reconstituted systems

    • Develop growth inhibition assays with qacE-expressing vs. non-expressing strains

    • Implement membrane potential assays to detect efflux activity

Assay Optimization Parameters:

ParameterOptimization ApproachCritical Considerations
Signal-to-noise ratioIterative buffer optimizationDetergent concentration, pH, ionic strength
Z-factorStatistical validation with known controlsMinimum acceptable Z' > 0.5
ReproducibilityIntra- and inter-plate controlsCV should be < 20%
Throughput capacityMiniaturization validationMaintain assay performance at 384/1536-well format
Interference assessmentCounter-screens for autofluorescence/quenchingInclude appropriate control wells

Compound Library Considerations:

  • Begin with focused libraries targeting membrane transporters or containing QAC structural analogs

  • Expand to diversity-oriented libraries for novel chemotype discovery

  • Include fragment libraries to identify minimal binding elements

  • Consider natural product libraries for unique structural motifs

Data Analysis and Hit Validation:

  • Implement dose-response confirmation studies for primary hits

  • Apply orthogonal secondary assays to eliminate false positives

  • Perform structure-activity relationship analysis for hit series

  • Validate target engagement through direct binding studies

  • Assess cytotoxicity and off-target effects for promising compounds

This systematic approach to HTS assay development enables efficient identification of compounds interacting with qacE while minimizing false positives and resource expenditure. The integration of both binding and functional assays provides a comprehensive assessment of compound effects on qacE activity .

What experimental controls are essential when investigating the role of qacE in biofilm formation and resistance?

When investigating the role of qacE in biofilm formation and resistance, implementing appropriate experimental controls is critical for generating reliable and interpretable data. The following comprehensive control framework should be incorporated:

Genetic Controls:

  • Wild-type strain with natural qacE expression

  • qacE deletion mutant (ΔqacE) to demonstrate gene-specific effects

  • Complemented strain (ΔqacE + qacE) to verify phenotype restoration

  • Overexpression strain to assess dose-dependent effects

  • Site-directed mutants with altered active sites to distinguish transport from other functions

Experimental Process Controls:

  • Technical replicates (minimum n=3) to assess methodological variation

  • Biological replicates (minimum n=3) using independent cultures

  • Time-series measurements to capture dynamic processes

  • Randomization of sample processing to minimize batch effects

  • Blinding procedures during analysis when feasible

Biofilm-Specific Controls:

  • Positive control strains known for robust biofilm formation

  • Negative control strains with biofilm deficiencies

  • Media controls without bacterial inoculation

  • Substrate controls evaluating different attachment surfaces

  • Flow condition controls (static vs. dynamic biofilms)

Antimicrobial Resistance Controls:

  • Susceptibility testing of planktonic cells for comparison

  • Inclusion of antibiotics with known mechanisms distinct from QACs

  • Graduated concentration series to establish dose-response relationships

  • Timed exposure studies to distinguish tolerance from resistance

  • Efflux pump inhibitor controls to confirm mechanism

Analysis Controls:

How can researchers effectively analyze qacE expression data to identify regulatory networks?

Effective analysis of qacE expression data to identify regulatory networks requires a systematic multi-omics approach combined with computational modeling. The following methodological framework provides a comprehensive strategy:

Data Generation and Integration:

  • Generate time-course gene expression data (RNA-Seq) under various conditions that affect qacE expression

  • Collect corresponding proteomics data to account for post-transcriptional regulation

  • Implement ChIP-Seq or similar techniques to identify direct DNA-protein interactions affecting qacE

  • Integrate with metabolomics data to capture metabolic influences on regulation

Computational Analysis Pipeline:

Analytical ApproachApplicationOutput
Differential Expression AnalysisIdentify conditions affecting qacE expressionStatistically significant expression changes
Co-expression Network AnalysisDetect genes with similar expression patternsGene clusters with potential functional relationships
Transcription Factor Binding Site AnalysisPredict regulatory elements in the qacE promoterPutative binding sites for transcription factors
Network Inference AlgorithmsReconstruct regulatory relationshipsDirected graph of regulatory interactions
Causal ModelingDistinguish direct from indirect effectsCausality networks with confidence scores

Validation Approaches:

  • Perform targeted promoter analyses using reporter constructs

  • Implement CRISPR interference to selectively repress predicted regulators

  • Conduct DNA-protein interaction assays to confirm direct binding

  • Apply mutagenesis to predicted binding sites to verify functionality

  • Use contradiction analysis to challenge predicted relationships

Integration and Visualization:

  • Develop integrated regulatory models incorporating multiple data types

  • Implement Bayesian networks to account for uncertainty in relationships

  • Visualize temporal dynamics of regulation using interactive tools

  • Compare regulatory networks across different bacterial species or strains

  • Apply machine learning to predict qacE expression under novel conditions

This comprehensive analytical framework enables researchers to move beyond simple correlative observations to develop causal models of qacE regulation. By integrating multiple data types and applying rigorous computational and experimental validation approaches, researchers can identify the key regulatory factors and network structures controlling qacE expression under various environmental conditions .

What statistical approaches are most appropriate for analyzing contradictory data regarding qacE function across different bacterial species?

When analyzing contradictory data regarding qacE function across bacterial species, researchers should employ rigorous statistical methodologies that explicitly account for both contradiction and uncertainty. The following statistical framework is recommended:

Preliminary Data Assessment:

  • Conduct meta-analysis of existing studies using random-effects models to account for between-study heterogeneity

  • Implement formal heterogeneity tests (I² statistic, Cochran's Q test) to quantify the degree of variation

  • Perform outlier detection to identify potentially anomalous results

  • Assess publication bias through funnel plots and Egger's test

Advanced Statistical Approaches:

  • Bayesian Hierarchical Modeling:

    • Implement species-specific parameters nested within a global model

    • Incorporate prior knowledge about species differences

    • Quantify uncertainty through credible intervals

    • Allow for partial pooling of information across species

  • Machine Learning Classification:

    • Train models to identify species characteristics associated with qacE functional variation

    • Implement cross-validation to assess predictive accuracy

    • Extract feature importance to identify key factors driving contradictions

    • Develop predictive models for untested species

  • Contradiction-Aware Analysis:

    • Explicitly model contradictory results rather than averaging them

    • Assign confidence scores to different experimental approaches

    • Combine contradiction and entailment signals in model formulation

    • Weight evidence based on methodological rigor

Multivariate Analysis for Mechanistic Insights:

  • Principal Component Analysis to identify patterns in functional parameters

  • Cluster Analysis to group species by functional similarity

  • Discriminant Analysis to identify characteristics distinguishing functional groups

  • Path Analysis to model potential causal relationships

Recommended Statistical Reporting:

  • Report effect sizes with confidence intervals rather than just p-values

  • Clearly state model assumptions and validation approaches

  • Provide sensitivity analyses for key parameters and assumptions

  • Make data and analysis code available for reproducibility

By applying these sophisticated statistical approaches, researchers can move beyond simply noting contradictions to understanding the biological basis for species-specific variation in qacE function. This approach embraces contradiction as an informative signal rather than noise, potentially revealing important biological insights about host-protein interactions and evolutionary adaptation .

How can machine learning approaches be applied to predict qacE substrate specificity based on molecular structure?

Machine learning (ML) approaches offer powerful methods for predicting qacE substrate specificity based on molecular structures of quaternary ammonium compounds (QACs). The following comprehensive methodological framework outlines an effective implementation strategy:

Data Acquisition and Preparation:

  • Compile a diverse dataset of QACs with known qacE interaction profiles

  • Generate molecular descriptors (physicochemical properties, topological indices, electronic parameters)

  • Calculate 3D structural fingerprints and conformational features

  • Implement data normalization and feature scaling

  • Address class imbalance if substrate/non-substrate datasets are uneven

Feature Engineering and Selection:

Feature TypeExamplesRelevance to qacE Interaction
Molecular descriptorsLipophilicity (logP), molecular weight, surface areaCapture general physicochemical properties
Structural fingerprintsECFP, MACCS keys, pharmacophore fingerprintsEncode substructure patterns
Quantum mechanical propertiesElectron density maps, HOMO/LUMO energiesRepresent electronic characteristics
Dynamic propertiesConformational flexibility, solvent accessibilityModel binding pocket interactions
Topological indicesConnectivity indices, shape descriptorsQuantify molecular shape and connectivity

Model Development Strategy:

  • Classification Models:

    • Support Vector Machines with various kernel functions

    • Random Forests for feature importance extraction

    • Gradient Boosting for high-performance prediction

    • Deep Neural Networks for complex pattern recognition

  • Regression Models:

    • Develop models to predict binding affinity or transport efficiency

    • Implement quantitative structure-activity relationship (QSAR) approaches

    • Apply Gaussian Process Regression for uncertainty quantification

  • Advanced Architectures:

    • Graph Neural Networks to directly process molecular graphs

    • Attention mechanisms to identify critical substructures

    • Transfer learning from related protein-ligand systems

Model Validation and Optimization:

  • Implement rigorous cross-validation (5-10 fold)

  • Perform external validation on held-out test compounds

  • Apply hyperparameter optimization through grid search or Bayesian optimization

  • Assess performance using multiple metrics (accuracy, precision, recall, F1-score, AUC)

  • Conduct Y-scrambling tests to detect chance correlations

Interpretability and Application:

  • Extract feature importance to identify key molecular determinants

  • Generate partial dependence plots to visualize feature-response relationships

  • Implement SHAP (SHapley Additive exPlanations) values for local interpretability

  • Develop visualization tools for structure-activity relationships

  • Create an accessible prediction tool for researchers to evaluate novel compounds

This systematic ML framework enables researchers to predict qacE substrate specificity for novel compounds and identify the molecular features driving substrate recognition. By combining rigorous computational approaches with experimental validation, researchers can accelerate the characterization of qacE-substrate interactions and inform the design of compounds that either evade or target this resistance mechanism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.