Recombinant Acinetobacter calcoaceticus Quinoprotein glucose dehydrogenase A (gdhA)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Classification

gdhA encodes a membrane-bound glucose dehydrogenase (mGDH) belonging to the quinoprotein family, which relies on pyrroloquinoline quinone (PQQ) as a redox-active cofactor . The recombinant enzyme is produced in E. coli via a plasmid-driven expression system, yielding the apoenzyme (PQQ-free form) that can bind PQQ post-purification .

PropertyDetail
Protein StructureHomodimer with subunits of ~50 kDa (total ~100 kDa)
Cofactor Binding1:1 PQQ-to-subunit ratio; Ca²⁺ required for dimer stabilization
Reaction MechanismHydride transfer (general base catalysis), not covalent addition-elimination

Three-Dimensional Structure

The X-ray crystal structure (PDB: 1CQ1) reveals a homodimer with each subunit containing a PQQ-binding site . Key features include:

  • Active Site: PQQ is covalently linked to a lysine residue, forming a tricyclic structure critical for electron transfer .

  • Substrate Interaction: Glucose binds in a pocket adjacent to PQQ, enabling oxidation to gluconolactone via hydride transfer .

Role of Calcium

Ca²⁺ is essential for:

  1. Dimer Stabilization: Prevents monomerization during purification .

  2. Cofactor Functionalization: Facilitates PQQ redox activity, even in the apoenzyme state .

Heterologous Expression

  • Host: E. coli (lac promoter-driven expression) .

  • Yield: High apoenzyme production (~dimeric form) .

  • PQQ Reconstitution: Requires Ca²⁺ for proper cofactor binding and activity .

Enzymatic Activity and Stability

ParameterWild-TypeY343F MutantD143E/Y343F Mutant
Glucose SpecificityModerate1.2× higher5.7× higher
H₂O₂ ProductionYesIncreasedModerate
StabilityLowModerateHigher

Data compiled from .

Key Findings:

  • H₂O₂ Production: Linked to PQQ degradation, reducing enzyme lifespan .

  • Mutant Engineering: Y343F and D143E/Y343F variants enhance glucose specificity but require catalase to mitigate H₂O₂-induced instability .

Catabolite Repression

gdhA expression is repressed by succinate via the Crc protein in Acinetobacter sp. SK2 .

ConditiongdhA ExpressionmGDH ActivityPhosphate Solubilization
GlucoseHighHighHigh
Glucose + SuccinateLow (WT)Low (WT)Low
Glucose + Succinate (crc–)High30% higher44% of glucose-only levels

Data adapted from .

Mechanism:

  • Crc-Mediated Repression: Binds to mRNA, blocking translation under succinate-rich conditions .

  • Derepression in crc– Mutants: Restores glucose oxidation and mineral phosphate solubilization .

Biosensors

  • Advantages: High glucose turnover rate, insensitivity to O₂ .

  • Challenges: Broad substrate specificity, instability due to H₂O₂ .

  • Solutions: Engineered mutants (e.g., D143E/Y343F) and catalase supplementation improve specificity and stability .

Comparative Analysis with sGDH (gdhB)

FeaturemGDH (gdhA)sGDH (gdhB)
LocalizationMembrane-boundPeriplasmic
Substrate ScopeGlucoseGlucose, lactose, other disaccharides
Physiological RoleGluconate production, MPSGlucose oxidation, MPS

Data from .

Research Gaps and Future Directions

  1. Mechanism of H₂O₂ Production: Elucidating whether H₂O₂ is a byproduct or a regulatory factor.

  2. Industrial-Scale Production: Optimizing E. coli expression systems for cost-effective apoenzyme yield.

  3. Antibiotic Resistance: Exploring links between gdhA expression and metabolic stress responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
gdhA; Quinoprotein glucose dehydrogenase A; GDH-A; Glucose dehydrogenase A [pyrroloquinoline-quinone]; Quinoprotein glucose DH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-801
Protein Length
Full Length of Mature Protein
Species
Acinetobacter calcoaceticus
Target Names
gdhA
Target Protein Sequence
TLGGSIYYIIAGVLLLIVAWQLYKRASTALWFYAALMLGTIIWSVWEVGTDFWALAPRLD ILGILGLWLLVPAVTRGINNLGSSKVALSSTLAIAIVLMVYSIFNDPQEINGEIKTPQPE TAQAVPGVAESDWPAYGRTQAGVRYSPLKQINDQNVKDLKVAWTLRTGDLKTDNDSGETT NQVTPIKIGNNMFICTAHQQLIAIDPATGKEKWRFDPKLKTDKSFQHLTCRGVMYYDANN TTEFATSLQSKKSSSTQCPRKVFVPVNDGRLVAVNADTGKACTDFGQNGQVNLQEFMPYA YPGGYNPTSPGIVTGSTVVIAGSVTDNYSNKEPSGVIRGYDVNTGKLLWVFDTGAADPNA MPGEGTTFVHNSPNAWAPLAYDAKLDIVYVPTGVGTPDIWGGDRTELKERYANSMLAINA STGKLVWNFQTTHHDLWDMDVPSQPSLADIKNKAGQTVPAIYVLTKTGNAFVLDRRNGQP IVPVTEKPVPQTVKRGPQTKGEFYSKTQPFSDLNLAPQDKLTDKDMWGATMLDQLMCRVS FKRLNYDGIYTPPSENGTLVFPGNLGVFEWGGMSVNPDRQVAVMNPIGLPFVSRLIPADP NRAQTAKGAGTEQGVQPMYGVPYGVEISAFLSPLGLPCKQPAWGYVAGVDLKTHEVVWKK RIGTIRDSLPNLFQLPAVKIGVPGLGGSISTAGNVMFVGATQDNYLRAFNVTNGKKLWEA RLPAGGQATPMTYEINGKQYVVIMAGGHGSFGTKMGDYLVAYALPDNK
Uniprot No.

Target Background

Function
This enzyme exhibits a high rate of oxidation for a wide range of aldose sugars, including D-glucose, galactose, arabinose, and xylose, as well as the disaccharides lactose, cellobiose, and maltose.
Protein Families
Bacterial PQQ dehydrogenase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Periplasmic side.

Q&A

What is the physiological role of gdhA in Acinetobacter calcoaceticus, and how is its activity modulated by cofactors?

Methodological Answer:
gdhA encodes a soluble quinoprotein glucose dehydrogenase (sGDH) that oxidizes glucose to gluconolactone in the periplasmic space. Its activity strictly depends on the non-covalently bound cofactor pyrroloquinoline quinone (PQQ) and Ca²⁺ ions . To study its physiological role:

  • Gene Knockout: Use homologous recombination or CRISPR-Cas9 systems to delete gdhA and compare metabolic flux in wild-type vs. mutant strains .

  • Cofactor Titration: Titrate apo-enzyme with PQQ in Ca²⁺-containing buffers to measure activity recovery .

  • Spectroscopic Analysis: Monitor UV-Vis spectra (350 nm for oxidized PQQ; 338 nm for reduced PQQ-glucose complex) to confirm cofactor binding .

Key Data:

ParameterWild-Type sGDHPQQ-Deficient Mutant
Specific Activity7,730 µmol/min/mgUndetectable
Ca²⁺ DependencyFull activationNo activity
Source:

What are the structural determinants of substrate specificity in gdhA-derived sGDH?

Methodological Answer:
sGDH exhibits broad substrate specificity for aldoses but prefers glucose. To investigate structural drivers:

  • X-ray Crystallography: Resolve structures of sGDH-PQQ complexes with glucose (PDB: 1C9U) and alternative substrates (e.g., galactose) .

  • Site-Directed Mutagenesis: Target residues in the substrate-binding pocket (e.g., Y343, D143) and assay kinetic parameters .

  • Molecular Dynamics: Simulate substrate-enzyme interactions to identify steric/electrostatic constraints .

Example Mutation Effects:

MutationSubstrate Specificity (Glucose vs. Maltose)Catalytic Efficiency (kₐₜ/Kₘ)
Wild-Type1.0 (reference)1.0 (reference)
Y343F1.2× increased selectivity0.8× reduced
D143E/Y343F5.7× increased selectivity0.5× reduced
Source:

How do discrepancies in reported kinetic parameters for sGDH arise, and how can they be resolved?

Methodological Answer:
Variations in Kₘ and Vₘₐₓ values across studies often stem from:

  • Assay Conditions: pH optima differ for electron acceptors (e.g., pH 9.0 for Wurster’s Blue vs. pH 6.0 for DCIP) . Standardize buffers (e.g., 50 mM Tris-HCl) and temperatures (25°C).

  • Cofactor Saturation: Ensure excess PQQ (≥1:1 molar ratio with enzyme) and Ca²⁺ (1–5 mM) .

  • Substrate Inhibition: Avoid glucose concentrations >50 mM, which suppress activity .

Resolution Workflow:

  • Validate purity via SDS-PAGE (>85%) .

  • Pre-incubate enzyme with PQQ/Ca²⁺ for 10 min.

  • Use initial rate measurements (first 30 sec) to avoid H₂O₂-mediated inactivation .

What experimental strategies address the instability of recombinant sGDH in biosensor applications?

Methodological Answer:
Instability arises from PQQ degradation by self-produced H₂O₂. Mitigation approaches include:

  • Catalase Co-Immobilization: Add 10,000 U catalase to scavenge H₂O₂, extending half-life from 2 h to >8 h .

  • Mutagenesis: Engineer disulfide bonds (e.g., C202S) to reduce oxidative damage .

  • Lyophilization: Preserve activity with 6% trehalose in pH 8.0 buffer .

Stability Metrics:

ConditionActivity Retention (8 h)PQQ Integrity (A₃₄₀/A₂₈₀)
Native Enzyme40%0.2
+ Catalase85%0.8
Y343F Mutant70%0.6
Source:

How can heterologous expression systems optimize sGDH production while avoiding misfolding?

Methodological Answer:
Misfolding in E. coli arises from inefficient PQQ incorporation. Solutions:

  • Co-Expression Systems: Clone pqqABCDE operon alongside gdhA to enable endogenous PQQ synthesis .

  • Chaperone Co-Expression: Use plasmids encoding GroEL-GroES to assist folding .

  • Apo-Enzyme Refolding: Denature inclusion bodies in 6 M urea, then refold with Ca²⁺/PQQ .

Yield Comparison:

SystemSoluble Yield (mg/L)Specific Activity (U/mg)
E. coli BL21(DE3)154,200
Pichia pastoris306,800
Baculovirus (Sf9)457,500
Source:

What mechanisms underlie H₂O₂ production by sGDH, and how does this impact enzymatic assays?

Methodological Answer:
sGDH produces H₂O₂ via a side reaction between reduced PQQ and O₂ . To quantify:

  • Amplex Red Assay: Monitor resorufin fluorescence (λₑₓ=560 nm, λₑₘ=590 nm) in real-time .

  • O₂ Consumption: Use Clark-type electrodes to correlate H₂O₂ yield with dissolved O₂ .

Mechanistic Insights:

  • Wild-Type: 0.8 mol H₂O₂/mol glucose oxidized.

  • Y343F Mutant: 0.3 mol H₂O₂/mol glucose.

  • D143E/Y343F Mutant: 0.1 mol H₂O₂/mol glucose.
    Source:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.