Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
HTR1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin 1D beta receptor; 5-HT-1D-beta; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MEEPGAQCAPPLAAGSQIAVPQANLSAAHSHNCSAEGYIYQDSIALPWKVLLVLLLALFT LATTLSNAFVVATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDLWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIRLVWVFSICI SLPPFFWRQAKAEEEVSECLVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTTSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGVFIVCWLPFFIISLVMPICKDACWFHQAIFDFFTWLGYV NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine receptor 1B (HTR1B) is a G-protein coupled receptor for 5-hydroxytryptamine (serotonin). It also acts as a receptor for various alkaloids and psychoactive substances. Ligand binding induces a conformational change, triggering signaling through guanine nucleotide-binding proteins (G proteins) and modulating the activity of downstream effectors, such as adenylate cyclase. This signaling pathway inhibits adenylate cyclase activity. Arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. HTR1B regulates the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, influencing neural activity, nociceptive processing, pain perception, mood, and behavior. Additionally, it plays a role in vasoconstriction of cerebral arteries.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the pharmacological profile of recombinant rabbit 5-HT1B receptors?

Recombinant rabbit 5-HT1B (rb 5-HT1B) receptors stably transfected in rat C6-glial cells exhibit distinct pharmacological properties. When characterized through adenosine 3':5'-cyclic monophosphate (cyclic AMP) formation measurements, these receptors show high-affinity binding for multiple serotonergic ligands. Specifically, intact C6-glial cells expressing rb 5-HT1B receptors demonstrate [3H]-5-carboxamidotryptamine (5-CT) binding sites with a Kd of 0.80±0.13 nM and a Bmax between 225 to 570 fmol mg-1 protein . The binding affinities of various 5-HT receptor ligands determined in membrane preparations are comparable between [3H]-5-CT and [3H]-GR 125,743 binding assays. With the notable exception of ketanserin, ligand affinities at rb 5-HT1B receptors closely resemble those at the human 5-HT1B receptor .

What are the signaling pathways associated with recombinant HTR1B receptors?

HTR1B is a G-protein coupled receptor that activates second messenger cascades to mediate inhibitory neurotransmission. The primary signaling mechanism involves negative coupling to adenylyl cyclase, resulting in inhibition of cyclic AMP formation upon stimulation with 5-HT agonists . Additionally, HTR1B activation can stimulate the MAPK/ERK signaling cascade, as demonstrated in studies with homologous receptors in other species . These signaling pathways regulate the release of several neurotransmitters including serotonin, dopamine, and acetylcholine in the brain .

How can recombinant rabbit HTR1B be expressed and characterized in cell culture systems?

For expression studies, the rb 5-HT1B receptor can be stably transfected into rat C6-glial cells, which provide an appropriate cellular environment for receptor expression and function . The expression and binding characteristics can be evaluated using radioligand binding assays with [3H]-5-CT or [3H]-GR 125,743 as radioligands. Functional characterization typically involves measuring changes in cyclic AMP levels using appropriate assay systems .

To establish similar systems with other HTR1 subtypes, the following protocol has been demonstrated effective: transiently express the receptor of interest in human embryonic kidney 293 (HEK293) cells and treat with 5-HT (10^-11 to 10^-7 M) or specific HTR1 agonists (10^-11 to 10^-5 M) for six hours. Receptor-activated signaling pathways can then be examined using pGL3-CRE-luciferase reporter systems for monitoring cAMP/PKA signaling pathways and pGL4-SRE-luciferase reporter systems for monitoring MAPK/ERK signaling pathways .

What are the recommended methods for studying HTR1B pharmacology?

For detailed pharmacological characterization of HTR1B, a systematic approach using both binding and functional assays is recommended. This includes:

  • Radioligand binding assays: Using [3H]-5-CT (Kd ≈ 0.80 nM) to determine binding affinities of various ligands. Alternative radioligands such as [3H]-GR 125,743 can also be employed .

  • Functional assays: Measuring cyclic AMP formation to assess the effects of both agonists and antagonists. For agonists, determine EC50 values and rank order potencies. For antagonists, determine pKB values using competitive antagonism models .

  • Comparative analysis: Compare binding affinities and functional potencies to establish structure-activity relationships and receptor selectivity profiles. The potency rank order for agonists at rb 5-HT1B is: 5-CT > 5-HT > zolmitriptan > naratriptan > rizatriptan > sumatriptan > R(+)-8-OH-DPAT .

What antibodies and detection methods are available for rabbit HTR1B research?

For immunological detection of HTR1B, polyclonal antibodies developed against recombinant HTR1B protein are available. These can be obtained through immunization with HTR1B recombinant protein (for example, corresponding to sequences like NM_000863) and purified through antigen affinity methods . Such antibodies have been validated for applications including:

  • ELISA: For quantitative assessment of HTR1B levels

  • Immunohistochemistry (IHC): Typically used at dilutions of 1:50-1:500 for detection in tissue sections, such as brain tissue

For optimal results in IHC applications, paraffin-embedded tissue sections should be used with appropriately diluted antibody (e.g., 1:100), and results can be visualized under both low (10x) and high (40x) magnification .

How does rb 5-HT1B receptor function in vascular hypersensitivity models?

  • Collar placement does not significantly alter pA2 values of 5-HT2A antagonists (spiperone, methysergide, ketanserin, and ritanserin), indicating unchanged binding characteristics of the 5-HT2A receptor.

  • The apparent pKb value of methiothepin (a 5-HT1B antagonist) is significantly reduced by collar placement, and its antagonism shifts from non-surmountable in sham rings to surmountable in collared segments .

These findings indicate that the 5-HT1B receptor subtype specifically mediates the hypersensitivity to 5-HT observed in rabbit collared carotid artery, offering an important model for studying vascular pathophysiology .

What experimental models exist for studying HTR1B in neuropsychiatric disorders?

HTR1B has been implicated in multiple neuropsychiatric disorders, including ADHD, antisocial behavior, aggressive behavior, bipolar disorder, anxiety/depression, schizophrenia, and substance abuse . Experimental models to study these associations include:

  • Genetic association studies: Investigating polymorphisms in the HTR1B gene (located on chromosome 6 at position 77,460,848–77,464,022 in humans) in patient cohorts. For example, studies have examined the relationship between HTR1B polymorphisms and schizophrenia in a cohort of 310 schizophrenic patients .

  • Gene expression analysis: Examining altered HTR1B mRNA levels in specific brain regions, such as the hippocampus in schizophrenic patients .

  • Pharmacological models: Using selective HTR1B agonists and antagonists to modulate receptor function in relevant behavioral paradigms.

It's worth noting that studies have shown inconsistent results regarding the genetic association between HTR1B variations and schizophrenia. For instance, rs2143823 is considered related to schizophrenia in Croatian populations, while no correlation was found between G861C and schizophrenia in Portuguese, German, and Brazilian patients .

How conserved is HTR1B across different species and what are the implications for comparative studies?

Synteny analyses have indicated that HTR1B is highly conserved across vertebrates, suggesting its evolutionary importance . This conservation enables comparative studies between different species models, including rabbit, human, and avian systems.

Studies in chicken have shown that HTR1B, along with related receptors HTR1E and HTR1F, are functional, capable of binding their natural ligands (5-HT) or selective agonists (CP94253, BRL54443, and LY344864) and inhibiting intracellular cAMP production in a dose-dependent manner . The functional conservation across species suggests that findings from one model organism may be applicable to others, though species-specific differences should always be considered.

The high degree of conservation makes rb 5-HT1B a valuable model for studying serotonergic mechanisms that may be translatable to human physiology and pathophysiology, particularly in the context of vascular and neuropsychiatric disorders.

What is the rank order potency of serotonergic agonists at rb 5-HT1B receptors?

The rank order potency of serotonergic agonists at rb 5-HT1B receptors has been well-characterized and follows this hierarchy:

5-CT > 5-HT > zolmitriptan > naratriptan > rizatriptan > sumatriptan > R(+)-8-OH-DPAT

This ordering is based on functional assays measuring inhibition of cyclic AMP formation in C6-glial cells expressing rb 5-HT1B receptors. The maximal responses elicited by these agonists are similar to those induced by 5-HT itself .

How do antagonists differ in their interactions with rabbit versus human HTR1B?

Several antagonists have been characterized at the rb 5-HT1B receptor, with notable differences compared to human HTR1B. Three key antagonists at rb 5-HT1B receptors are:

  • GR 127,935: Functions as a silent, competitive antagonist with a pKB value of 8.41 when tested against naratriptan.

  • Methiothepin: Acts as a silent, competitive antagonist with a pKB value of 8.32 when tested against naratriptan.

  • Ketanserin: Functions as a silent, competitive antagonist with a pKB value of 7.05 when tested against naratriptan.

The most significant species difference is observed with ketanserin, which is a more potent antagonist at rb 5-HT1B receptors compared to human 5-HT1B receptors . This difference should be considered when extrapolating findings between species or when designing selective pharmacological interventions.

What functional assays best differentiate between HTR1B and other serotonin receptor subtypes?

To differentiate HTR1B from other serotonin receptor subtypes, several complementary functional assays are recommended:

  • cAMP inhibition assays: HTR1B typically couples negatively to adenylyl cyclase, resulting in inhibition of forskolin-stimulated cAMP production. This can be measured using reporter systems like pGL3-CRE-luciferase .

  • MAPK/ERK signaling assays: HTR1B activation can stimulate the MAPK/ERK pathway, which can be monitored using pGL4-SRE-luciferase reporter systems .

  • Specific agonist/antagonist profiling: Using selective compounds such as:

    • CP94253 (selective HTR1B agonist)

    • GR 127,935 (HTR1B/HTR1D antagonist)

    • Methiothepin (5-HT1 antagonist with high affinity for HTR1B)

  • Tissue-specific functional assays: In rabbit models, contraction of isolated saphenous vein segments can be used to differentiate HTR1B-mediated responses .

The combination of these approaches, along with careful pharmacological profiling using receptor subtype-selective compounds, provides the most comprehensive differentiation between HTR1B and other serotonin receptor subtypes.

What are common challenges in expressing functional recombinant rabbit HTR1B?

Researchers may encounter several challenges when expressing functional rb 5-HT1B receptors:

  • Transfection efficiency: Achieving sufficient and stable expression in C6-glial cells requires optimization of transfection conditions and selection procedures.

  • Receptor density variation: Studies have shown that Bmax values can vary between 225 to 570 fmol mg-1 protein , which may affect experimental outcomes and reproducibility.

  • Post-translational modifications: These may differ between expression systems and native tissues, potentially affecting receptor pharmacology.

  • Coupling efficiency: The efficiency of G-protein coupling and downstream signaling may vary between expression systems and should be validated.

To address these challenges, it is advisable to carefully characterize receptor expression levels using radioligand binding assays and to validate functional coupling through multiple complementary assays.

How can researchers resolve discrepancies in pharmacological profiling of HTR1B?

When facing discrepancies in pharmacological profiling of HTR1B receptors, consider the following systematic approach:

  • Standardize experimental conditions: Ensure consistent cell culture conditions, passage numbers, and expression levels.

  • Use multiple radioligands: Compare binding profiles using both [3H]-5-CT and [3H]-GR 125,743 to verify consistency in affinity measurements .

  • Employ orthogonal functional assays: Combine measurements of cAMP inhibition, MAPK/ERK activation, and calcium signaling where applicable.

  • Consider species differences: Remember that significant differences exist between rabbit and human HTR1B, particularly regarding antagonist affinities (e.g., ketanserin) .

  • Verify receptor selectivity: Use selective agonists and antagonists to confirm that observed effects are specifically mediated by HTR1B rather than other receptor subtypes.

By systematically addressing these factors, researchers can resolve discrepancies and ensure reliable pharmacological characterization of HTR1B receptors.

How might recombinant rabbit HTR1B models contribute to understanding neuropsychiatric disorders?

Recombinant rabbit HTR1B models offer valuable insights into neuropsychiatric disorders through several research avenues:

  • Pharmacological validation: rb 5-HT1B receptors share significant pharmacological similarities with human HTR1B , making them useful for validating novel therapeutic compounds targeting disorders like anxiety, depression, and schizophrenia.

  • Signaling pathway elucidation: Studies in recombinant systems allow detailed mapping of signaling cascades that may be dysregulated in disorders associated with serotonergic dysfunction .

  • Genetic variant modeling: The impact of genetic variants identified in human studies can be modeled in recombinant systems to understand their functional consequences. This is particularly relevant given findings of increased HTR1B mRNA levels in the hippocampus of schizophrenic patients .

  • Drug discovery applications: The established pharmacological profile of rb 5-HT1B receptors provides a foundation for screening and developing selective ligands with potential therapeutic applications.

By leveraging these approaches, recombinant rabbit HTR1B models can contribute significantly to our understanding of the role of serotonergic signaling in neuropsychiatric disorders and facilitate development of targeted interventions.

What novel experimental techniques are advancing HTR1B research?

Recent advancements in experimental techniques are revolutionizing HTR1B research:

  • CRISPR/Cas9 gene editing: Enables precise modification of HTR1B sequences to study structure-function relationships and model disease-associated variants.

  • Advanced reporter systems: Dual-luciferase reporter assays allow simultaneous monitoring of multiple signaling pathways, such as combining pGL3-CRE-luciferase (cAMP/PKA signaling) with pGL4-SRE-luciferase (MAPK/ERK signaling) .

  • High-throughput screening platforms: Facilitate identification of novel ligands with selective actions at HTR1B receptors.

  • Structural biology approaches: Advances in cryo-electron microscopy and X-ray crystallography are providing insights into the three-dimensional structure of G-protein coupled receptors, including serotonin receptors.

  • In silico modeling: Computational approaches enable prediction of ligand binding sites and pharmacological properties based on receptor structure.

These technological advances are accelerating the pace of HTR1B research and opening new avenues for understanding receptor function and developing therapeutic interventions.

What are the binding and functional parameters for key ligands at recombinant rabbit HTR1B?

Table 1: Binding and Functional Parameters of Key Ligands at Recombinant Rabbit HTR1B

LigandBinding Affinity (Kd/Ki)Functional Parameter (EC50/IC50)ClassificationReference
5-CT0.80±0.13 nM (Kd)Highest potencyFull agonist
5-HT-Second highest potencyFull agonist
Zolmitriptan-Third highest potencyFull agonist
Naratriptan-Fourth highest potencyFull agonist
Rizatriptan-Fifth highest potencyFull agonist
Sumatriptan-Sixth highest potencyFull agonist
R(+)-8-OH-DPAT-Lowest potencyFull agonist
GR 127,935-pKB = 8.41Silent antagonist
Methiothepin-pKB = 8.32Silent antagonist
Ketanserin-pKB = 7.05Silent antagonist

Note: All functional parameters were determined using naratriptan as an agonist for antagonist studies. The binding site density (Bmax) in C6-glial cells expressing rb 5-HT1B receptors ranges from 225 to 570 fmol mg-1 protein .

How do experimental parameters for HTR1B transfection and expression vary across studies?

Table 2: Experimental Parameters for HTR1B Transfection and Expression Systems

Cell LineTransfection MethodSelectionExpression LevelAssay SystemSpeciesReference
Rat C6-glial cellsStable transfectionNot specified225-570 fmol mg-1 protein[3H]-5-CT binding, cAMP formationRabbit
HEK293Transient expressionNot applicableNot specifiedpGL3-CRE-luciferase, pGL4-SRE-luciferaseChicken

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.