Recombinant Rabbit Adenosine receptor A3 (ADORA3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rabbit ADORA3

Recombinant Rabbit ADORA3 refers to the full-length adenosine A3 receptor (319 amino acids) cloned from Oryctolagus cuniculus and expressed in E. coli with an N-terminal His-tag for purification . This receptor is part of the adenosine receptor family, which regulates cellular responses through inhibition of adenylyl cyclase and modulation of mitogen-activated protein kinase (MAPK) pathways . Its recombinant form enables high-purity isolation for biochemical and pharmacological studies.

Key Features:

PropertyDetails
SpeciesRabbit (Oryctolagus cuniculus)
Expression SystemE. coli
TagN-terminal His-tag
Amino Acid SequenceMPDNSTTLFLAIRASYIVFEIVIGVCAVVGNVLVIWVIKLNPSLKTTTFYFIFSLALADIAVGFLVMP... (319 residues)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

The receptor’s structure includes seven transmembrane domains typical of GPCRs, with extracellular loop 3 (ECL3) playing a critical role in ligand selectivity . The recombinant protein retains native binding affinity for adenosine agonists like IB-MECA and antagonists such as MRS1523 .

Functional Roles and Mechanisms

Recombinant Rabbit ADORA3 is implicated in:

  • Cardioprotection: Induces late preconditioning against myocardial infarction by activating PI3K/Akt pathways, reducing mitochondrial permeability transition pore (mPTP) opening .

  • Anti-Inflammatory Effects: Inhibits neutrophil degranulation and cytokine release via Gi protein coupling .

  • Species-Specific Signaling: Exhibits 76% sequence homology with human ADORA3, but ligand affinity varies significantly (e.g., IB-MECA has higher potency in rabbits) .

Research Findings in Preclinical Models

  • Ischemia-Reperfusion Injury: Activation of recombinant rabbit ADORA3 with IB-MECA reduced infarct size by 40% in conscious rabbit models .

  • Ligand Binding: Competition assays using rabbit spleen membranes (enriched in A3AR) showed 70% binding specificity for [¹²⁵I]AB-MECA, confirming functional integrity .

  • Cross-Species Studies: Chimeric receptors combining rabbit ECL3 with human ADORA3 demonstrated retained agonist selectivity, highlighting ECL3’s role in ligand recognition .

Applications in Biomedical Research

  • Drug Development: Used to screen selective agonists (e.g., CF101) and antagonists for inflammatory and cardiovascular therapies .

  • Structural Biology: Facilitates cryo-EM studies to resolve agonist-bound conformations .

  • Antibody Production: Serves as an antigen for polyclonal antibodies validated in Western blot (e.g., ab203298) .

Species-Specific Considerations

Species ComparisonSequence Identity vs. Human ADORA3Functional Divergence
Rabbit76%Higher A3AR density in spleen
Rat72%Reduced cardioprotective effects
Rhesus Monkey97%Near-identical ligand response

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your convenience.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of that tag.
Synonyms
ADORA3; Adenosine receptor A3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MPDNSTTLFLAIRASYIVFEIVIGVCAVVGNVLVIWVIKLNPSLKTTTFYFIFSLALADI AVGFLVMPLAIVISLGITIGFYSCLVMSCLLLVFTHASIMSLLAIAVDRYLRVKLTVRYR RVTTQRRIWLALGLCWVVSLLVGFTPMFGWNMKPTLESARNYSDFQCKFDSVIPMEYMVF FSFFTWILIPLLLMCALYVYIFYIIRNKLVQSFSSFKETGAFYRREFKTAKSLFLVLALF AGCWLPLSIINCVTYFKCKVPDVVLLVGILLSHANSMMNPIVYACKIQKFKETYLLIFKA RVTCQPSDSLDPSSEQNSE
Uniprot No.

Target Background

Function
Adenosine receptor A3 (ADORA3) is a receptor for adenosine. Its activity is mediated by G proteins that inhibit adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Adenosine A3 receptor (A3AR) and what is its significance in research?

The Adenosine A3 receptor is a G protein-coupled receptor that has emerged as a promising therapeutic target for various pathophysiological conditions, particularly cardiovascular disorders and inflammatory conditions. A3AR is extensively studied because of its involvement in ameliorating cardiovascular complications through various signaling pathways. Recent research has demonstrated that A3AR plays a crucial role in cardioprotection, making it an important therapeutic target for cardiovascular diseases . Additionally, A3AR has been implicated in inflammatory and cancerous conditions, further expanding its research significance .

As a member of the adenosine receptor family, A3AR has unique pharmacological properties that distinguish it from other adenosine receptor subtypes (A1, A2A, and A2B), making it valuable for selective therapeutic targeting. The rabbit A3AR model is particularly important as it shares significant homology with human A3AR while exhibiting distinct pharmacological profiles that allow for comparative studies .

What are the key structural features of A3AR in rabbits?

Rabbit A3AR exhibits several distinctive structural features that influence its ligand binding properties and signaling capabilities. The receptor contains seven transmembrane domains characteristic of G protein-coupled receptors, with an extracellular N-terminus and intracellular C-terminus. Recent cryo-EM structures of human A3AR have revealed that the orthosteric binding pocket accommodates agonists through specific interactions, and similar principles likely apply to rabbit A3AR .

The rabbit A3AR contains unique amino acid residues in the binding pocket that contribute to its distinctive pharmacological profile. Of particular importance is extracellular loop 3, which plays a critical role in ligand selectivity and receptor activation. Key residues including His 3.37, Ser 5.42, and Ser 6.52 form a unique sub-pocket that significantly impacts receptor activation .

Rabbit A3AR differs from other species in its binding affinity for certain ligands. For instance, while the human and rabbit A3AR share significant sequence homology, there are notable differences that affect ligand selectivity and potency .

How can recombinant rabbit A3AR be detected in experimental systems?

Detection of recombinant rabbit A3AR expression can be accomplished through several complementary techniques:

  • RT-PCR Analysis: RT-PCR followed by Southern blotting can be used to detect A3AR mRNA expression in rabbit tissues or isolated cardiomyocytes. This technique can distinguish between A3AR and other adenosine receptor subtypes, as demonstrated in studies examining A3AR expression in rabbit heart ventricular myocardium and isolated ventricular cardiomyocytes .

  • Radioligand Binding Assays: [125I]AB-MECA (N6-(4-amino-3-[125I]iodobenzyl)adenosine-5′-N-methylcarboxamide) is commonly used as a radioligand for detecting A3AR binding sites. Competition binding assays with selective ligands can differentiate A3AR from other adenosine receptor subtypes .

  • Functional cAMP Assays: Recombinant rabbit A3AR function can be assessed by measuring inhibition of isoproterenol-induced cAMP accumulation in transfected cells. This approach allows for pharmacological characterization of the receptor and evaluation of ligand potency and efficacy .

What are the optimal binding assay conditions for studying recombinant rabbit A3AR?

Radioligand binding assays for rabbit A3AR require careful optimization to ensure reliable results:

Recommended Protocol:

  • Cell Expression System: HEK 293 cells transfected with rabbit A3AR cDNA provide a reliable system for receptor expression. The rabbit A3AR cDNA can be cloned from a rabbit brain cDNA library .

  • Membrane Preparation: Prepare membranes from transfected cells following standard protocols for GPCR membrane isolation.

  • Radioligand Selection: [125I]AB-MECA is the preferred radioligand for A3AR binding studies due to its high affinity for the receptor. Use at concentrations near the Kd value (approximately 0.3-0.4 nM for rabbit A3AR) .

  • Competition Binding: For selectivity studies, include a range of competing ligands at concentrations from 10^-10 to 10^-4 M.

  • Assay Conditions: Conduct binding assays in buffer containing 50 mM Tris-HCl (pH 7.4), 10 mM MgCl2, and 1 mM EDTA at 25°C for 60-90 minutes to reach equilibrium.

Analysis Guidelines:

The reported Kd and Bmax values for [125I]AB-MECA binding to recombinant rabbit A3AR are approximately 0.39±0.11 nM and 1033±433 fmol/mg membrane protein, respectively . When analyzing competition binding data, use nonlinear regression to determine IC50 values, which can be converted to Ki values using the Cheng-Prusoff equation.

How can one differentiate between A1AR and A3AR binding in radioligand binding studies?

Differentiating between A1AR and A3AR binding is essential due to their overlapping pharmacological profiles. The following methodological approach is recommended:

Selective Ligands Table:

LigandKi for rabbit A1AR (nM)Ki for rabbit A3AR (nM)Selectivity Ratio
CCPA1.5±0.5565±180377-fold (A1-selective)
IB-MECA54±182.6±0.921-fold (A3-selective)
CPX (antagonist)0.4±0.13100±11007750-fold (A1-selective)
N-0861 (antagonist)3.0±1.64200±19001400-fold (A1-selective)

Tissue-Specific Expression:

  • In rabbit brain, approximately 85% of [125I]AB-MECA binding sites are A1AR, 2% are A3AR, and 13% are A2AAR

  • In rabbit spleen, approximately 25% of binding sites are A1AR, 70% are A3AR, and 5% are A2AAR

Methodological Approach:

  • Use selective concentrations of [125I]AB-MECA (6 nM for A1AR-enriched tissues, 0.3 nM for A3AR-enriched tissues)

  • Include selective competitors (CCPA for A1AR, IB-MECA for A3AR)

  • Use xanthine antagonists (like CPX) which effectively block A1AR but have minimal effect on A3AR

  • Consider tissue source (brain for A1AR, spleen for A3AR) when establishing baseline parameters

This differentiation is crucial as IB-MECA, while A3AR-selective, still exhibits significant A1AR binding that must be accounted for in experimental design and data interpretation .

What signaling pathways are activated by A3AR stimulation in cardiac tissue?

A3AR stimulation in cardiac tissue activates several protective signaling cascades that contribute to cardioprotection:

Key Signaling Pathways:

  • PI3K/Akt Pathway: A3AR activation leads to phosphorylation and activation of PI3K/Akt, which subsequently inhibits glycogen synthase kinase. This signaling cascade plays a crucial role in inhibiting the opening of the mitochondrial permeability transition pore (mPTP), a critical event in myocardial ischemia/reperfusion injury .

  • Anti-Inflammatory Mechanisms: A3AR activation reduces neutrophil activation during reperfusion, thereby attenuating inflammation-mediated tissue damage. This effect has been observed in isolated rabbit hearts and contributes to the cardioprotective actions of A3AR agonists .

  • G Protein Coupling: A3AR primarily couples to Gi proteins, leading to inhibition of adenylyl cyclase and reduced cAMP production. Recent cryo-EM structures have revealed that A3AR agonists induce conformational changes that facilitate G protein coupling, with the α5 helix of Gαi occupying the intracellular domains of the activated receptor .

  • Age-Dependent Modulation: The efficacy of A3AR-mediated cardioprotection may be age-dependent, as aging is associated with reduced A3AR expression. Studies have shown decreased A3AR and increased A2BAR mRNA levels with aging, similar to changes observed during ischemia in young hearts .

Understanding these signaling mechanisms is essential for developing therapeutic strategies that target A3AR for cardioprotection and for designing experiments to evaluate A3AR function in cardiac tissue.

How does A3AR activation contribute to cardioprotection in ischemia/reperfusion models?

A3AR activation offers significant cardioprotection in ischemia/reperfusion models through multiple mechanisms:

Preconditioning Effects:
A3AR agonist administration 24 hours prior to ischemic insult induces late preconditioning, resulting in approximately 35-40% reduction in infarct size following 30 minutes of coronary artery occlusion in conscious rabbits . This preconditioning effect involves complex signaling cascades that prepare the myocardium to better withstand subsequent ischemic stress.

Post-Ischemic Protection:
A particularly valuable aspect of A3AR-mediated cardioprotection is that it can be achieved when agonists are administered after the onset of ischemia or during reperfusion. This has important clinical implications for the treatment of acute myocardial infarction, where pre-treatment is rarely possible .

Experimental Timeline for Post-Ischemic Protection:

  • Induce ischemia (e.g., 30 minutes of coronary artery occlusion)

  • Administer A3AR agonist at the onset of reperfusion

  • Assess infarct size after 3 days of reperfusion

  • Compare to control groups receiving vehicle only

Mitochondrial Protection:
A key mechanism of A3AR-mediated cardioprotection involves preventing the opening of the mitochondrial permeability transition pore (mPTP), which plays a crucial role in myocardial ischemia/reperfusion injury. A3AR activation inhibits mPTP opening through the PI3K/Akt pathway and subsequent inhibition of glycogen synthase kinase .

Species-Dependent Effects:
Cardioprotective effects of A3AR activation have been demonstrated in multiple species including rabbit, rat, guinea pig, and dog hearts, suggesting evolutionary conservation of this protective mechanism .

What are the challenges in developing selective A3AR agonists and antagonists?

Developing selective A3AR ligands presents several challenges that researchers must address:

Major Challenges:

  • Cross-Reactivity with A1AR: Many A3AR ligands exhibit significant binding to A1AR due to structural similarities between the receptors. For example, IB-MECA, while A3AR-preferring, is only 21-fold selective versus A1AR in rabbit models . True selectivity requires careful structural modifications and rigorous pharmacological testing.

  • Species Differences: Significant differences exist between human and rabbit A3AR sequences, resulting in species-dependent pharmacology. Many antagonists developed for human A3AR bind with much lower affinity to rabbit and other rodent A3ARs . These species differences complicate translational research and necessitate species-specific drug development.

  • Xanthine Resistance: Unlike other adenosine receptor subtypes, rabbit A3AR is resistant to blockade by xanthine antagonists, limiting the available pharmacological tools . This unique property requires alternative chemical scaffolds for antagonist development.

  • Structure-Activity Relationships: Developing selective A3AR ligands requires precise modifications of adenosine derivatives. The most successful approach has involved modifications to both the ribose and adenine moieties:

    • 5'-N-methylcarboxamide substitution on the ribose group

    • N6-(3-iodobenzyl) substitution on the adenine base

    These combined modifications significantly enhance A3AR potency compared to the endogenous agonist adenosine .

  • Identifying Critical Binding Residues: Recent cryo-EM structures have revealed that mutations in specific residues (His 3.37, Ser 5.42, and Ser 6.52) in a unique sub-pocket of A3AR significantly impact receptor activation . Understanding these critical interaction points is essential for rational drug design.

What expression systems are recommended for producing recombinant rabbit A3AR?

For optimal expression and characterization of recombinant rabbit A3AR, the following methodological approach is recommended:

Recommended Expression Systems:

  • HEK 293 Cell Line: This human embryonic kidney cell line is the preferred expression system for rabbit A3AR due to its high transfection efficiency, robust protein expression, and low endogenous adenosine receptor expression. Transfection with rabbit A3AR cDNA cloned from a rabbit brain cDNA library has been successfully employed .

  • Expression Vector Selection: Mammalian expression vectors containing strong promoters (CMV, SV40) facilitate high-level expression. For biochemical and structural studies, addition of epitope tags (FLAG, His, etc.) enables purification and detection.

Transfection Protocol:

  • Maintain HEK 293 cells in DMEM supplemented with 10% FBS and antibiotics

  • Seed cells at 70-80% confluence for transfection

  • Transfect using calcium phosphate precipitation or lipid-based reagents

  • Select stable transfectants using appropriate antibiotic resistance markers

  • Verify expression by radioligand binding assays, Western blotting, or functional assays

Expression Verification:
Radioligand binding with [125I]AB-MECA can confirm successful expression. Typical expression levels in optimized HEK 293 cell systems yield Bmax values of approximately 1033±433 fmol/mg membrane protein .

Alternative Systems:
For structural studies requiring higher protein yields, insect cell expression systems (Sf9, High Five) using baculovirus vectors may be preferred, though these systems may exhibit different post-translational modifications compared to mammalian cells.

How can functional activity of recombinant rabbit A3AR be assessed?

Multiple complementary approaches can be employed to assess the functional activity of recombinant rabbit A3AR:

cAMP Inhibition Assay:
A3AR couples to Gi proteins, inhibiting adenylyl cyclase and reducing cAMP production. This property forms the basis for a functional assay:

  • Stimulate cAMP production in A3AR-expressing cells using forskolin or β-adrenergic agonists (e.g., isoproterenol)

  • Add A3AR agonists at various concentrations

  • Measure cAMP levels by radioimmunoassay or ELISA

  • Calculate EC50 values to determine agonist potency

In HEK 293 cells expressing recombinant rabbit A3AR, the EC50 value for IB-MECA is approximately 0.55±0.11 nM, while CCPA exhibits an EC50 of 59.0±12.2 nM .

G Protein Coupling Assays:

  • NanoBiT Association Assays: These assays can determine the selectivity of ligands for A3AR as opposed to other adenosine receptor subtypes. Using this approach, selective agonists like CF101 and CF102 display strong potency (~nM range) for A3AR while showing minimal activity at other adenosine receptor subtypes .

  • [35S]GTPγS Binding: This assay directly measures G protein activation by quantifying the exchange of GDP for GTP on the Gα subunit.

Receptor Internalization Assays:
Measuring agonist-induced receptor internalization using fluorescently-tagged receptors or antibodies can provide insights into receptor activation and desensitization mechanisms.

Downstream Signaling:
Monitoring phosphorylation of signaling proteins in the PI3K/Akt pathway can assess functional consequences of A3AR activation in cardiac tissue models .

What experimental models are appropriate for studying A3AR-mediated cardioprotection?

Several experimental models have been validated for investigating A3AR-mediated cardioprotection:

In Vivo Models:

  • Conscious Rabbit Model:

    • Instrumentation: Implant a balloon occluder around a major branch of the left coronary artery, with bipolar ECG leads on the chest wall. In some studies, a Doppler thickening crystal can be sutured to the epicardial surface to measure wall thickening.

    • Protocol: Allow 10+ days recovery post-surgery, then subject rabbits to 30 minutes of coronary artery occlusion followed by 3 days of reperfusion.

    • Preconditioning: Administer A3AR agonist (e.g., IB-MECA at 100-300 μg/kg IV) 24 hours before ischemia.

    • Assessment: Measure infarct size as a percentage of the region at risk .

  • Rodent Models: Rat and mouse models of myocardial ischemia/reperfusion have been employed, though species differences in A3AR pharmacology must be considered .

Ex Vivo Models:

  • Isolated Heart Preparations: Langendorff-perfused rabbit, rat, guinea pig, or dog hearts allow for controlled study of ischemia/reperfusion injury and assessment of A3AR agonist effects when administered during reperfusion .

Cellular Models:

  • Primary Cardiomyocytes: Isolated rabbit ventricular cardiomyocytes can be obtained by enzymatic digestion with collagenase for cellular-level studies of A3AR signaling .

  • H9c2 Cardiomyoblasts: This cell line can be used for mechanistic studies of A3AR signaling pathways and cardioprotection.

Biomarkers and Endpoints:

  • Infarct size (triphenyltetrazolium chloride staining)

  • Cardiac function (echocardiography, pressure-volume loops)

  • Mitochondrial function (mPTP opening, oxygen consumption)

  • Inflammatory markers (neutrophil infiltration, cytokine levels)

  • Apoptotic markers (TUNEL staining, caspase activation)

These models collectively provide comprehensive insights into the cardioprotective effects of A3AR activation across different experimental paradigms.

What do recent structural studies reveal about A3AR ligand binding mechanisms?

Recent cryo-electron microscopy (cryo-EM) studies have provided unprecedented insights into A3AR structure and ligand interactions:

Key Structural Findings:

Recent cryo-EM structures of the full-length human A3AR bound to selective agonists CF101 and CF102 in complex with heterotrimeric Gi protein at 3.3-3.2 Å resolution have revealed critical details about ligand recognition and receptor activation .

Ligand Binding Pocket Architecture:

  • The A3AR selective agonists reside in the orthosteric pocket of the receptor

  • The adenine moieties of these agonists form conserved interactions with the receptor binding pocket

  • Interestingly, while the adenine interactions are conserved, the 3-iodobenzyl groups of these ligands exhibit distinct orientations within the binding pocket

Critical Binding Residues:
Mutational studies coupled with structural data have identified key residues in a unique sub-pocket of A3AR that significantly impact receptor activation:

  • His 3.37

  • Ser 5.42

  • Ser 6.52

These residues form specific interactions with selective agonists that contribute to their high affinity and selectivity for A3AR .

Ligand Modifications and Selectivity:
The structural studies have illuminated how specific chemical modifications confer selectivity:

  • 5'-N-methylcarboxamide substitution on the ribose group

  • N6-(3-iodobenzyl) substitution on the adenine base

These combined modifications result in significantly higher A3AR potency compared to the endogenous agonist adenosine .

Activation Mechanism:
Comparative analysis with inactive A2AAR structures highlights a conserved receptor activation mechanism despite the pharmacological differences between adenosine receptor subtypes. This suggests a common structural basis for GPCR activation that is modulated by subtype-specific interactions .

How does aging affect A3AR expression and function in cardiovascular research?

Aging significantly impacts A3AR expression and function, with important implications for cardiovascular research:

Age-Related Changes in A3AR Expression:

Research has demonstrated that aging is associated with reduced A3AR expression in cardiac tissue. Specifically, Ashton et al. reported decreased A3AR and increased A2BAR mRNA levels with aging, similar to changes observed during ischemia in young hearts . Additionally, a reduction in A1AR has been observed during ischemia in aged hearts.

Functional Consequences:

These age-dependent alterations in adenosine receptor expression patterns may explain some of the conflicting results observed in cardioprotection studies. The reduced expression of cardioprotective A1AR and A3AR subtypes in aged hearts could potentially limit the efficacy of adenosine receptor-targeted therapies in elderly populations .

Research Implications:

  • Age-Appropriate Models: Researchers should consider using age-appropriate animal models that reflect the target clinical population when evaluating A3AR-targeted therapies.

  • Differential Receptor Expression: Experimental designs should account for potential differences in receptor expression between young and aged subjects.

  • Compensatory Mechanisms: The increased expression of A2BAR in aged hearts may represent a compensatory mechanism that could be therapeutically exploited.

  • Personalized Medicine Approach: These findings suggest that adenosine receptor-targeted therapies may need to be tailored based on patient age and receptor expression profiles.

Understanding the interplay between aging and adenosine receptor subtype expression is crucial for developing effective therapeutic strategies for cardiovascular protection in elderly populations, who are at increased risk for cardiovascular events .

What are the emerging therapeutic applications of selective A3AR modulators?

Selective A3AR modulators show promising therapeutic potential across several clinical areas:

Cardiovascular Applications:

  • Acute Myocardial Infarction: A3AR agonists administered post-ischemia or during reperfusion protect the heart by reducing infarct size, suggesting potential use as adjunctive therapy during percutaneous coronary intervention or thrombolysis .

  • Cardiac Surgery: A3AR agonist pretreatment could provide cardioprotection during planned procedures involving ischemia-reperfusion, such as coronary artery bypass grafting or heart transplantation .

  • Heart Failure: Chronic A3AR modulation may influence cardiac remodeling and improve long-term outcomes following myocardial injury.

Inflammatory Conditions:

A3AR has emerged as a promising therapeutic target for inflammatory conditions. Selective A3AR agonists like CF101 have been investigated in clinical trials for inflammatory diseases due to their ability to modulate immune cell function and inflammatory mediator production .

Cancer Applications:

Evidence suggests that A3AR modulation may have anti-neoplastic effects. The selective A3AR agonist CF102 has shown promise in preclinical and early clinical studies for certain cancers .

Current Clinical Development:

The selective A3AR agonists CF101 and CF102 represent clinically significant compounds that have progressed to human studies, highlighting the translational potential of A3AR-targeted therapies .

Challenges and Future Directions:

  • Selectivity Optimization: Further refinement of ligand selectivity to minimize off-target effects on other adenosine receptor subtypes remains an important goal.

  • Biased Signaling: Developing agonists with biased signaling properties could potentially separate therapeutic effects from unwanted side effects.

  • Delivery Strategies: Novel delivery systems or prodrug approaches may improve the pharmacokinetic properties of A3AR modulators.

  • Combination Therapies: A3AR modulators might show synergistic effects when combined with existing treatments for cardiovascular disease, inflammation, or cancer.

The continued development of selective A3AR modulators, guided by structural insights and mechanistic understanding, holds promise for addressing unmet medical needs across multiple therapeutic areas.

What are common pitfalls in A3AR research and how can they be addressed?

Researchers working with recombinant rabbit A3AR may encounter several methodological challenges:

Challenge 1: Receptor Expression Variability

  • Problem: Inconsistent or low expression levels of recombinant A3AR in heterologous systems.

  • Solution: Optimize transfection conditions, use codon-optimized cDNA constructs, and consider stable cell lines rather than transient transfection. Verify expression levels using radioligand binding assays before conducting functional experiments.

Challenge 2: Species Differences in Pharmacology

  • Problem: Extrapolating results from rabbit to human studies can be problematic due to species-dependent pharmacology.

  • Solution: Always include appropriate species controls and be cautious when interpreting cross-species data. Consider using human A3AR in parallel experiments for translational relevance.

Challenge 3: Ligand Selectivity Issues

  • Problem: Limited selectivity of available ligands between A3AR and other adenosine receptor subtypes.

  • Solution: Always include selective antagonists for other adenosine receptor subtypes to isolate A3AR-specific effects. In binding studies, use conditions that maximize selectivity for A3AR (e.g., appropriate radioligand concentration).

Challenge 4: Confounding Effects of Endogenous Adenosine

  • Problem: Endogenous adenosine can compete with exogenous ligands and activate multiple receptor subtypes.

  • Solution: Include adenosine deaminase in experimental buffers to degrade endogenous adenosine. For in vivo studies, consider adenosine uptake inhibitors to control endogenous adenosine levels.

Challenge 5: Age-Dependent Receptor Expression

  • Problem: A3AR expression decreases with age, complicating studies in aged models.

  • Solution: Age-match experimental groups carefully and quantify receptor expression levels. Consider age-dependent dosing of A3AR ligands to account for expression differences.

How can researchers optimize experimental design for studying A3AR-mediated cardioprotection?

Optimizing experimental design is crucial for obtaining reliable and translatable results in A3AR cardioprotection research:

Recommended Experimental Protocol:

  • Animal Selection and Preparation:

    • Use rabbits weighing 2.2-2.9 kg

    • Allow minimum 10-day recovery after surgical instrumentation

    • Ensure proper analgesia and animal welfare throughout

  • Instrumentation:

    • Implant balloon occluder around a major branch of the left coronary artery

    • Place bipolar ECG leads on chest wall

    • Consider Doppler thickening crystal on epicardial surface to measure wall thickening

  • Ischemia-Reperfusion Protocol:

    • 30 minutes of coronary artery occlusion

    • 3 days of reperfusion for infarct size assessment

    • Verify ischemia by ECG changes and wall motion abnormalities

  • Drug Administration:

    • For preconditioning: administer A3AR agonist (e.g., IB-MECA 100-300 μg/kg IV) 24 hours before ischemia

    • For post-ischemic protection: administer at onset of reperfusion

  • Controls and Comparisons:

    • Include vehicle control groups

    • Consider selective A1AR agonist (CCPA) for comparison

    • Include antagonist groups to confirm receptor specificity

  • Assessment Parameters:

    • Primary endpoint: infarct size (percentage of area at risk)

    • Secondary endpoints: cardiac function, arrhythmias, biomarkers

Statistical Considerations:

  • Power analysis to determine appropriate sample size (typically 8-10 animals per group)

  • Account for potential mortality (approximately 15-20%)

  • Use appropriate statistical tests (ANOVA with post-hoc analysis)

This optimized protocol, based on established methods from the literature, provides a robust framework for investigating A3AR-mediated cardioprotection in conscious rabbit models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.