Recombinant Rabbit Alpha-1D adrenergic receptor (ADRA1D)

Shipped with Ice Packs
In Stock

Description

Recombinant Rabbit Alpha-1D Adrenergic Receptor (ADRA1D): Overview

The recombinant rabbit Alpha-1D adrenergic receptor (ADRA1D) is a synthetic version of the rabbit-specific alpha-1D adrenergic receptor, a G-protein-coupled receptor (GPCR) that mediates sympathetic nervous system responses. ADRA1D is encoded by the ADRA1D gene and plays roles in vasoconstriction, smooth muscle contraction, and cellular proliferation. Recombinant ADRA1D proteins are produced in heterologous systems (e.g., E. coli, yeast, or mammalian cells) for research purposes, including ligand-binding studies, antibody validation, and functional assays .

Production and Expression Systems

Recombinant ADRA1D is synthesized using recombinant DNA technology, often via bacterial or eukaryotic expression systems. Key production methods include:

Expression SystemDescriptionApplications
E. coliProkaryotic host for high-yield production; partial proteins or full-length receptors expressed.Structural studies, ligand-binding assays .
YeastEukaryotic system for post-translational modifications; used for functional studies.Membrane protein folding, signal transduction assays .
Mammalian cellsHuman or rodent cell lines for native-like receptor expression; used for pharmacological profiling.Studying receptor-ligand interactions, G-protein coupling .

Examples of commercially available recombinant ADRA1D include:

  • CSB-CF001387RB: Full-length rabbit ADRA1D expressed in E. coli .

  • CSB-YP001387RB1: Partial rabbit ADRA1D expressed in yeast or mammalian systems .

Amino Acid Sequence and Homology

The rabbit ADRA1D protein consists of 576 amino acids, sharing strong sequence homology with human, rat, and mouse orthologs . Key structural features include:

  • Seven transmembrane α-helices: Critical for ligand binding and G-protein coupling .

  • Conserved aspartic acid residue (Asp125): Mediates ion-pair interactions with catecholamine ligands .

Pharmacological Binding Properties

Recombinant ADRA1D exhibits ligand-binding profiles comparable to native rabbit receptors. For example:

  • Antagonists: BMY 7378 (α2C antagonist) and Cyclazosin (α1C-selective) show cross-reactivity .

  • Agonists: Non-selective α1-AR agonists like phenylephrine activate ADRA1D .

Ligand-Binding and Functional Assays

Recombinant ADRA1D is used to:

  1. Validate ligand selectivity: Determine affinity of antagonists (e.g., BMY 7378) or agonists (e.g., A61603) .

  2. Study G-protein coupling: Assess activation of Gq/11 pathways linked to calcium influx and mitogenic responses .

Antibody Validation

Polyclonal antibodies (e.g., MBS8248057) are tested against recombinant ADRA1D for specificity in Western blotting, immunohistochemistry (IHC), and immunofluorescence (IF) .

Disease Modeling

  • Cardiovascular research: ADRA1D is studied in rabbit models to explore its role in hypertension and cardiac hypertrophy .

  • Ocular studies: ADRA1D mRNA is detected in rabbit iris and choroid, linking it to intraocular pressure regulation .

Tissue Distribution and Subtype Prevalence

While endogenous ADRA1D mRNA is <1% in rabbit heart, it is abundant in:

TissueADRA1D mRNA LevelKey Functions
Vas deferensHighSmooth muscle contraction .
AortaModerateVasoconstriction .
Cerebral cortexModerateNeurological signaling .

In contrast, the alpha-1B subtype dominates rabbit myocardium (>99% mRNA), while alpha-1D is negligible .

Research Challenges and Future Directions

  • Low endogenous expression: Recombinant ADRA1D compensates for limited native receptor availability .

  • Ligand selectivity: Most α1-AR ligands are non-subtype-specific, necessitating engineered mutants or selective agonists .

  • Therapeutic potential: ADRA1D’s role in cognition, metabolism, and cardioprotection remains underexplored .

References

  1. [Alpha-1D adrenergic receptor (Wikipedia)]

  2. [Cusabio ADRA1D Products]

  3. [PLOS One: Rabbit α1A-AR in Heart]

  4. [PubMed: Rabbit α1D Cloning]

  5. [MyBioSource: ADRA1D Antibody]

  6. [PMC: Rabbit Ocular α1-AR Subtypes]

  7. [Frontiers: α1-AR Roles]

  8. [Circulation Research: α1-AR Structure]

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRA1D; Alpha-1D adrenergic receptor; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-576
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MTFRDLLSVTFEGPRPDISAGGSGAGGGAGAGAGAGDTASSESPAVGGVPGAAGGGGGGS VVGAGSGEDNRSSAGEPGGAGGGGEVNGTAAVGGLVVSAQSVGVGVFLAAFILTAVAGNL LVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAV DVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSMGPLLGW KEPVPPDERFCGITEEVGYAVFSSLCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRE RGKASEVVLRIHCRGAASGADGAPGTRGAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVG VFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLR LLRCQCRRRRRRRPLWRVYGHHWRASAGGGPHPDCALSAGAALPGAALALTAAPAPSSAA APEGQAAGAGRRKPPCAFREWRLLGPLRRPTTQLRAKVSSLSHKIRAGGAQRAEAACALR SEVEAVALSVARDVAEDNTCQAYELADYRNLRETDI
Uniprot No.

Target Background

Function
This alpha-adrenergic receptor mediates its effects through the influx of extracellular calcium.
Database Links

KEGG: ocu:100009398

UniGene: Ocu.2132

Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1D sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rabbit Alpha-1D adrenergic receptor (ADRA1D) and how is it classified?

Rabbit Alpha-1D adrenergic receptor (ADRA1D) is a G protein-coupled receptor that belongs to the adrenergic receptor family. It is activated by the catecholamines norepinephrine and epinephrine, functioning as an intrinsic membrane glycoprotein . ADRA1D is classified within the GPCR superfamily and specifically within the class A GPCR family .

The receptor has been known by several other names throughout scientific literature, including ADRA1, ADRA1A, ADRA1R, ALPHA1, and dJ779E11.2 . This receptor is involved in important physiological pathways including calcium signaling, neuroactive ligand-receptor interaction, and vascular smooth muscle contraction .

What is the distribution pattern of ADRA1D in rabbit tissues?

In rabbit ocular tissues, ADRA1D represents a minor subtype of alpha-1 adrenergic receptors. Based on competitive RT-PCR assays, the mRNA expression of ADRA1D is very low, constituting less than 0.5% of total alpha-1 ARs mRNA in the iris, ciliary body, choroid, and retina .

In contrast, alpha-1a AR was found to be the dominant subtype at the mRNA level in rabbit ocular tissues . This distribution pattern is important for researchers to consider when designing experiments targeting specific alpha-1 receptor subtypes in rabbit tissue models.

Tissueα-1a ARα-1b ARα-1d AR
IrisDominant<10%<0.5%
Ciliary bodyDominant<10%<0.5%
ChoroidDominant<10%<0.5%
RetinaDominant<10%<0.5%

Data based on competitive RT-PCR assays of rabbit ocular tissues

What techniques are recommended for detecting ADRA1D expression at the mRNA level?

For detecting ADRA1D at the mRNA level, competitive RT-PCR and in situ hybridization (ISH) have proven to be effective techniques. When implementing competitive RT-PCR assays, it's crucial to co-transcribe and co-amplify the total RNA from each tissue with a competing RNA to achieve quantitative results .

Methodological approach:

  • Extract total RNA from the tissue of interest

  • Design primers specific for ADRA1D, avoiding cross-reactivity with other alpha-1 receptor subtypes

  • Develop a competing DNA/RNA construct as an internal standard

  • Co-transcribe and co-amplify the sample with the competing RNA

  • Analyze the results using gel electrophoresis and densitometry

This approach allows for relative quantification of ADRA1D mRNA expression in comparison to other alpha-1 receptor subtypes, as demonstrated in studies of rabbit ocular tissues .

What antibodies and ELISA kits are available for rabbit ADRA1D detection?

For protein-level detection of rabbit ADRA1D, both polyclonal antibodies and ELISA kits are commercially available:

Antibody options:
Rabbit anti-ADRA1D polyclonal antibodies are available for various applications including Western blotting. These antibodies typically show reactivity to human, mouse, and rat ADRA1D, with potential cross-reactivity to rabbit ADRA1D . When selecting an antibody, consider:

  • Recommended dilution (typically 1:500 for Western blotting)

  • Clonality (polyclonal antibodies provide broader epitope recognition)

  • Purification method (protein A purification is common)

  • Storage conditions (typically -20°C in PBS with 0.05% sodium azide)

ELISA kit characteristics:
ELISA kits specific for rabbit ADRA1D offer sensitive and specific detection with minimal cross-reactivity to analogous proteins. Performance metrics include:

  • Standard deviation less than 8% for standards repeated 20 times on the same plate

  • Less than 10% variation when the same sample is measured by different operators

  • High specificity with no significant cross-reactivity with ADRA1D analogues

How should I design experiments to distinguish ADRA1D activity from other alpha-1 AR subtypes?

Designing experiments to specifically target ADRA1D requires careful consideration of receptor pharmacology and experimental controls. Given that ADRA1D is a minor subtype in many rabbit tissues (e.g., ocular tissues), differentiating its activity from other alpha-1 subtypes presents a methodological challenge .

Recommended approach:

  • Pharmacological isolation: Utilize selective antagonists with differential affinities for alpha-1 receptor subtypes. While there are no completely selective agonists for ADRA1D, antagonist profiles can help distinguish receptor subtypes .

  • Genetic approaches: Consider using:

    • Competitive RT-PCR with subtype-specific primers to quantify relative expression levels before functional studies

    • RNA interference to selectively downregulate ADRA1D

    • Heterologous expression systems expressing only ADRA1D

  • Tissue selection: Focus on tissues known to have relatively higher ADRA1D expression or use transfected cell models expressing only ADRA1D.

  • Control experiments: Always include parallel experiments with selective antagonists for alpha-1A and alpha-1B subtypes to rule out their contribution to observed effects.

  • Variables to control:

    • Temperature (affects receptor binding kinetics)

    • pH (influences ligand-receptor interactions)

    • Presence of divalent cations (particularly important for G-protein coupling)

    • Time course (receptor desensitization differs between subtypes)

Remember that non-catecholamine agonists such as methoxamine and amidephrine have both low affinity and low intrinsic activity at the ADRA1D receptor, making them less useful for selective activation .

What are the critical variables to control in ADRA1D binding studies?

When conducting binding studies with ADRA1D, several variables must be carefully controlled to ensure reliable and reproducible results :

  • Temperature: Maintain consistent temperature throughout the experiment as it affects binding kinetics. Typically, binding assays are performed at either room temperature (25°C) or physiological temperature (37°C).

  • Buffer composition:

    • pH (typically 7.4)

    • Ionic strength (affects non-specific binding)

    • Presence of divalent cations (Mg²⁺, Ca²⁺) which influence G-protein coupling

    • Reducing agents to maintain cysteine residues in their reduced state

  • Ligand characteristics:

    • Use of radiolabeled or fluorescent ligands with high specific activity

    • Concentration range (covering at least 2 orders of magnitude around the expected Kd)

    • Incubation time (sufficient to reach equilibrium)

  • Receptor preparation:

    • Consistent membrane preparation techniques

    • Protein concentration determination

    • Storage conditions to maintain receptor integrity

  • Non-specific binding determination: Always include parallel assays with an excess of unlabeled competing ligand (typically 100-1000× the Kd) to determine non-specific binding.

  • Experimental design considerations:

    • Randomization of treatment groups

    • Technical replicates (minimum triplicates)

    • Positive controls (known ligands with established binding parameters)

By systematically controlling these variables and applying proper experimental design principles, researchers can minimize variability and obtain reliable binding data for ADRA1D receptors .

How do ADRA1D binding mechanisms compare to other adrenergic receptors?

ADRA1D binding mechanisms share some similarities with other adrenergic receptors but also display important differences that researchers should consider when designing experiments:

Similarities with other adrenergic receptors:

  • Like β-adrenergic receptors (βARs), the helical transmembrane regions of ADRA1D are arranged in a bundle to form a binding pocket for hydrophilic catecholamines .

  • Binding of catecholamines likely involves an ion-pair interaction between the protonated amine of the ligand and the carboxylate side chain of a conserved aspartic acid in the third transmembrane segment .

Differences from β-adrenergic receptors:

  • Unlike β2AR where mutation of Ser204 to alanine decreases binding affinity by 10-fold and reduces intrinsic activity of full agonists, mutation of the corresponding residue (Ser208) in α1BAR does not alter receptor affinity for natural catecholamine ligands .

  • This suggests that the determinants of agonist binding and receptor activation are not entirely conserved among adrenergic receptors .

  • With α1BAR, only hydrogen bonding between one hydroxyl and a single serine (likely Ser207) appears to be involved in receptor activation, whereas β2AR requires hydrogen bonding of both catechol hydroxyls to serine residues .

These mechanistic differences have important implications for drug design and selectivity studies targeting ADRA1D versus other adrenergic receptor subtypes.

What approaches can be used to study constitutive activity in ADRA1D?

Studying constitutive activity in ADRA1D (spontaneous activity in the absence of agonist) requires specialized approaches:

Methodological approaches:

  • Mutagenesis studies: Based on findings with related receptors, certain mutations can induce constitutive activity:

    • Mutation of specific residues in transmembrane domains, particularly in the third transmembrane segment, can produce constitutively active receptors .

    • For example, with α1BAR, mutation of a cysteine residue (Cys128) to phenylalanine produces a receptor that is constitutively active for PI turnover but not for PLA2-mediated arachidonic acid release .

  • Signaling pathway analysis: Measure basal activity of multiple signaling pathways:

    • Phosphoinositide (PI) turnover assays

    • Calcium mobilization measurements

    • Arachidonic acid release via PLA2 activation

    • MAP kinase phosphorylation status

  • Inverse agonist studies: Use of inverse agonists (ligands that reduce constitutive activity) can help quantify the degree of constitutive activity. The difference between baseline activity and activity in the presence of a saturating concentration of inverse agonist provides a measure of constitutive activity.

  • Expression level control: Since constitutive activity often correlates with receptor expression levels, using inducible expression systems allows titration of receptor density and correlation with baseline activity.

These approaches can help distinguish between true constitutive activity and experimental artifacts, providing insights into the intrinsic regulatory properties of ADRA1D .

How can I address inconsistencies between mRNA and protein expression data for ADRA1D?

Researchers frequently encounter discrepancies between mRNA expression levels and corresponding protein abundance for ADRA1D. These inconsistencies can arise from multiple factors and require systematic troubleshooting:

Potential causes of inconsistencies:

  • Post-transcriptional regulation: mRNA may be transcribed but not efficiently translated due to microRNA regulation or RNA binding proteins.

  • Protein degradation: ADRA1D protein may be subject to rapid turnover via ubiquitin-proteasome pathways, particularly when not properly folded or trafficked to the membrane.

  • Methodological limitations:

    • RT-PCR sensitivity versus Western blot detection limits

    • Antibody specificity issues

    • Sample preparation differences between RNA and protein extractions

Recommended troubleshooting approaches:

  • Validate detection methods:

    • Confirm primer specificity for RT-PCR using positive and negative controls

    • Validate antibody specificity using recombinant ADRA1D and knockout/knockdown controls

    • Check for cross-reactivity with other alpha-1 AR subtypes

  • Multi-method verification:

    • Complement RT-PCR with in situ hybridization for mRNA localization

    • Use multiple antibodies targeting different epitopes of ADRA1D

    • Consider functional assays to measure receptor activity

  • Time-course analysis: Monitor both mRNA and protein levels over time to identify temporal relationships and potential delays between transcription and translation.

  • Subcellular fractionation: Analyze membrane-bound versus cytosolic fractions to determine if trafficking issues affect detected protein levels.

By systematically addressing these factors and employing multiple complementary techniques, researchers can develop a more complete understanding of ADRA1D expression and regulation .

What statistical approaches are most appropriate for analyzing ADRA1D pharmacological data?

Recommended statistical approaches:

  • Dose-response analysis:

    • Nonlinear regression to fit sigmoidal dose-response curves

    • Calculation of EC50/IC50 values with 95% confidence intervals

    • Statistical comparison of curves using extra sum-of-squares F test to detect shifts in potency or efficacy

  • Binding studies:

    • Scatchard analysis or nonlinear regression for Kd and Bmax determination

    • One-site versus two-site binding models compared via F-test or AIC

    • Analysis of competitive binding data using the Cheng-Prusoff equation to calculate Ki values

  • Experimental design considerations:

    • Power analysis to determine adequate sample size

    • Randomized block design to control for day-to-day variability

    • Latin square design for complex multi-factor experiments

  • Quality control metrics:

    • For ELISA-based detection, standard deviations should be less than 8% for repeated standards and less than 10% for samples measured by different operators

    • Z'-factor calculation for high-throughput assays

    • Coefficient of variation (CV) reporting for technical and biological replicates

  • Multiple comparison corrections:

    • Bonferroni or Šidák corrections for family-wise error rate control

    • False discovery rate control methods (e.g., Benjamini-Hochberg) for large-scale studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.