Recombinant Rabbit Alpha-2B adrenergic receptor (ADRA2B)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Gene Characteristics

The rabbit ADRA2B gene encodes a 450-amino acid protein spanning seven transmembrane domains (TMs) . Key structural features include:

ParameterDetails
Gene SymbolADRA2B (also known as alpha-2B adrenoreceptor or alpha-2BAR)
Chromosomal Location2q11.2 (human), 2 61.95 cM (mouse), 3q36 (rat)
Protein Length450 amino acids (AA)
Key DomainsPolyglutamyl domain in the third intracellular loop; binding sites for agonists/antagonists

The receptor’s long third intracellular loop contains a polyglutamyl domain, which exhibits significant length variations across species and influences receptor desensitization .

Functional Roles and Physiological Significance

ADRA2B mediates diverse physiological processes:

Neurotransmitter Regulation

ADRA2B inhibits adenylate cyclase via G-protein coupling, reducing cyclic AMP levels and modulating sympathetic outflow . It works synergistically with α2A and α2C receptors to regulate presynaptic neurotransmitter release .

Blood Pressure Modulation

ADRA2B exhibits species-specific effects:

  • Humans/Rabbits: Increases blood pressure via vascular smooth muscle contraction .

  • Mice: Contributes to embryonic development, as knockout models show reduced survival rates .

Emotional Memory and Stress Responses

A deletion variant in the ADRA2B gene (lacking three glutamic acids) is linked to enhanced emotional memory and amygdala hyperactivity. This variant:

  • Amplifies negative emotional processing .

  • Predisposes individuals to focus on negative stimuli, even after reboxetine treatment .

  • Modulates stress-induced shifts from cognitive to habit memory, potentially influencing PTSD susceptibility .

Recombinant Production and Applications

Recombinant rabbit ADRA2B is produced using bacterial systems (e.g., E. coli) with His-tag fusion for purification . Key production parameters:

ParameterDetails
Expression SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE validated)
ApplicationsSDS-PAGE, receptor-ligand interaction studies, drug discovery

Research Applications

  • Ligand Binding Studies: Recombinant ADRA2B is used to test agonists (e.g., clonidine) and antagonists (e.g., yohimbine) .

  • Drug Development: Serves as a target for subtype-selective adrenergic antagonists (e.g., BAY-6096) .

  • Protein-Protein Interactions: Investigates association with eIF-2B and spinophilin, critical for hypertensive responses .

Ligand Pharmacology

ADRA2B exhibits distinct ligand selectivity:

Ligand TypeExamplesPotency Rank
AgonistsClonidine > Norepinephrine > EpinephrineHigh affinity for α2B-specific agonists
AntagonistsYohimbine > Chlorpromazine > PhentolamineSelective inhibition of α2B-mediated pathways

Obesity and Metabolism

A polymorphic variant of ADRA2B with reduced phosphorylation is associated with lower basal metabolic rates in obese individuals, contributing to weight gain .

Neurological Disorders

  • PTSD/Anxiety: Deletion variant carriers show heightened amygdala reactivity to emotional stimuli .

  • Schizophrenia/ADHD: α2B receptor involvement in sensorimotor gating and compulsivity suggests therapeutic potential .

Comparative Genetics and Evolution

ADRA2B serves as a phylogenetic marker for mammalian clades (e.g., Xenarthra, Afrotheria) due to its intronless structure and conserved residues in agonist-binding domains .

Challenges and Future Directions

  • Specificity: Limited subtype-selective ligands hinder functional dissection .

  • Therapeutic Targets: Recombinant ADRA2B aids in developing drugs for hypertension, PTSD, and obesity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRA2B; Alpha-2B adrenergic receptor; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNCKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQGPQPHGAPQCKLNQEAWYILSSSLGSFFVPCLIMILVYL RIYLIAKRSHRRGPRAKGGPGEGESRQACPVPGGPSASAKLPTLATPVASASEANGPSKP AGEKEEGETPEDPGTQALPPGWATLPNSGQGQKEGVSGASLEEEAEEEEEEEEEEDEPQA VPVSPASVGSPPLQQPQGSRVLATLRGQVLVGRGVGAMSGQWWRRRAQLSREKRFTFVLA VVIGVFVLCWFPFFFSYSLSAICPQQCRVPHGLF
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of rabbit ADRA2B and how does it compare to human ADRA2B?

Rabbit ADRA2B (adrenoceptor alpha 2B) is a seven-transmembrane G-protein coupled receptor encoded by the ADRA2B gene (Gene ID: 100352237) in Oryctolagus cuniculus . The receptor protein (XP_008252079.2) is translated from the mRNA transcript XM_008253857.2 . While complete structural characterization data specifically for rabbit ADRA2B is limited in the provided search results, the human ortholog consists of 450 amino acids with a characteristic GPCR structure featuring seven transmembrane domains .

Comparative analysis between rabbit and human ADRA2B would typically reveal high sequence conservation in transmembrane domains and ligand-binding regions, with greater variability in intracellular loops and C-terminal regions that interact with signaling proteins. When designing experiments, researchers should consider these structural similarities and differences, particularly when extrapolating findings between species or developing selective compounds.

What are the key functional properties of ADRA2B receptors in neurological research?

ADRA2B belongs to the α2-adrenergic receptor family, which includes three highly homologous subtypes: α2A, α2B, and α2C. These receptors play essential roles in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system . ADRA2B specifically has been observed to associate with eIF-2B, a guanine nucleotide exchange protein that functions in regulation of translation .

In neurological research, ADRA2B is particularly significant due to its associations with several conditions including Epilepsy, Familial Adult Myoclonic, and Benign Adult Familial Myoclonic Epilepsy . Additionally, research on human ADRA2B has shown that a deletion variant is associated with emotional memory processing and predisposes individuals to focus more on negative aspects of situations . These findings suggest important roles for ADRA2B in both neurological function and emotional processing, making it a valuable target for comparative studies using rabbit models.

What are the optimal expression systems for producing functional recombinant rabbit ADRA2B?

The choice of expression system for recombinant rabbit ADRA2B production depends on research objectives, required protein yield, and downstream applications. Based on advancements in recombinant protein production technology, several systems can be adapted for ADRA2B expression:

  • Mammalian Cell Expression Systems: These provide the most native-like post-translational modifications and are ideal for functional studies. HEK293 cells are particularly suitable for GPCR expression due to their human origin and appropriate membrane composition. For rabbit ADRA2B expression, transient transfection using systems like the triple plasmid transfection can yield approximately 10^4-10^6 vector genomes (vg) per cell .

  • Baculovirus Expression System: This system offers advantages for membrane protein expression including GPCRs. The baculovirus system using Sf9 insect cells has achieved productivity of approximately 5 × 10^4 vg/cell for recombinant proteins . For optimal expression of rabbit ADRA2B, baculovirus-specific promoters should be used instead of natural promoters, with expression cassettes controlled by baculovirus immediate early (ΔIE1) and polyhedrin (polh) promoters .

  • Stable Cell Lines: For consistent, long-term production, creating stable mammalian cell lines expressing rabbit ADRA2B can achieve yields of up to 5 × 10^5 vg/cell , though development time is longer than transient methods.

When designing expression systems for rabbit ADRA2B, particular attention should be paid to codon optimization for the host cell, inclusion of appropriate signal sequences, and addition of purification tags that minimally impact receptor function.

How can researchers optimize the purification protocol for recombinant rabbit ADRA2B to maintain functional integrity?

Purification of recombinant rabbit ADRA2B requires specialized approaches due to its membrane-embedded nature. A methodological approach would include:

  • Membrane Isolation: Following expression, cells should be disrupted using methods that preserve protein structure (e.g., nitrogen cavitation or gentle sonication) followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Critical step requiring careful detergent selection. Mild detergents like n-dodecyl-β-D-maltopyranoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin are preferable. Screening multiple detergents at various concentrations (typically 0.5-2%) is recommended to determine optimal conditions that maintain receptor function.

  • Affinity Chromatography: If the recombinant ADRA2B contains affinity tags (His, FLAG, etc.), corresponding affinity resins can be used for initial purification. For tag-free approaches, ligand-based affinity chromatography using immobilized alpha-2 receptor ligands can be employed.

  • Size Exclusion Chromatography: Final polishing step to remove aggregates and ensure homogeneity of the purified receptor.

Throughout the purification process, receptor functionality should be monitored using radiolabeled ligand binding assays or functional coupling to G proteins. Stabilizing agents such as cholesterol hemisuccinate and specific ligands can be added to maintain the receptor in its native conformation during purification.

What are the most effective methods for characterizing ligand binding properties of recombinant rabbit ADRA2B?

Characterizing ligand binding properties of recombinant rabbit ADRA2B requires multiple complementary approaches:

  • Radioligand Binding Assays: The gold standard for quantitative assessment of binding affinities and receptor densities.

    • Saturation Binding: Using increasing concentrations of a radiolabeled alpha-2 selective ligand (e.g., [³H]-yohimbine or [³H]-RX821002) to determine Bmax (receptor density) and KD (binding affinity).

    • Competition Binding: Measuring displacement of a fixed concentration of radioligand by increasing concentrations of unlabeled compounds to determine Ki values.

  • Fluorescence-Based Methods:

    • FRET or BRET assays using fluorescently-tagged ligands and receptors

    • Fluorescent ligand binding assays using environment-sensitive fluorophores

  • Surface Plasmon Resonance (SPR): For real-time, label-free measurement of binding kinetics (kon and koff rates).

  • Thermostability Assays: Methods like CPM (7-diethylamino-3-(4'-maleimidylphenyl)-4-methylcoumarin) fluorescence to assess receptor stability in different conditions and with different ligands.

The choice of method depends on specific research questions, available equipment, and the physicochemical properties of the ligands being studied. Data analysis should include appropriate controls and statistical methods to account for non-specific binding, receptor denaturation during preparation, and species-specific differences in binding properties.

How should researchers design functional assays to characterize G-protein coupling of recombinant rabbit ADRA2B?

Functional characterization of G-protein coupling for recombinant rabbit ADRA2B should employ multiple complementary assays:

  • GTPγS Binding Assays: Measures receptor-stimulated G protein activation by quantifying the binding of non-hydrolyzable GTP analog [³⁵S]GTPγS to Gα subunits following agonist stimulation. This assay provides direct measurement of G protein activation and can be performed with membrane preparations containing the recombinant receptor.

  • Second Messenger Assays:

    • cAMP Inhibition Assays: Since ADRA2B couples primarily to Gαi/o proteins, measuring inhibition of forskolin-stimulated cAMP production using ELISA, radioimmunoassay, or FRET-based sensors provides functional readouts.

    • Ca²⁺ Mobilization: Measuring intracellular calcium release using fluorescent indicators (Fura-2, Fluo-4) to detect Gβγ-mediated signaling.

  • BRET-Based G Protein Dissociation Assays: Using bioluminescence resonance energy transfer between tagged G protein subunits to detect conformational changes upon receptor activation in real-time in living cells.

  • ERK Phosphorylation: Measuring downstream MAPK pathway activation through western blotting or ELISA for phosphorylated ERK1/2.

Assay design should include appropriate positive controls (known alpha-2 agonists like clonidine, UK14,304) and negative controls (antagonists like yohimbine), concentration-response curves, and time-course measurements. Comparison with human ADRA2B responses under identical conditions provides valuable insights into species-specific signaling properties.

How can structural differences between rabbit and human ADRA2B be leveraged for selective drug design?

Leveraging structural differences between rabbit and human ADRA2B for selective drug design requires a systematic approach:

  • Comparative Sequence Analysis: While the search results don't provide the complete sequence alignment, researchers should perform detailed sequence comparisons between rabbit (XP_008252079.2) and human (P18089) ADRA2B to identify non-conserved residues, particularly within the ligand-binding pocket and G-protein interaction domains .

  • Homology Modeling and Molecular Dynamics: Generate 3D structural models of both receptors based on available GPCR crystal structures. Molecular dynamics simulations can reveal species-specific differences in:

    • Ligand binding pocket architecture

    • Receptor flexibility and conformational states

    • Allosteric binding sites

    • Water networks and solvent accessibility

  • Mutagenesis Studies: Based on identified differences, design point mutations to convert rabbit-specific residues to their human counterparts (and vice versa) to determine the functional significance of these differences.

  • Pharmacological Profiling: Screen compound libraries against both rabbit and human ADRA2B to identify molecules with species selectivity, then perform structure-activity relationship (SAR) analysis to understand the molecular basis of selectivity.

  • Fragment-Based Drug Design: Target species-specific binding pockets with fragment libraries, then grow compounds to enhance selectivity.

This approach can lead to the development of valuable research tools such as species-selective ligands that can be used to probe receptor function in different model systems and potentially lead to improved therapeutic compounds with reduced off-target effects.

What are the methodological approaches for studying ADRA2B oligomerization and its functional significance?

Studying ADRA2B oligomerization requires specialized techniques to capture protein-protein interactions in membrane environments:

  • Resonance Energy Transfer Techniques:

    • FRET/BRET: By tagging rabbit ADRA2B with appropriate fluorescent/luminescent proteins (e.g., CFP/YFP for FRET, Rluc/YFP for BRET), researchers can detect oligomerization in living cells. These techniques can be expanded to investigate:

      • Constitutive vs. ligand-induced oligomerization

      • Homo- vs. hetero-oligomerization (with other adrenergic receptors)

      • Spatial organization in different cellular compartments

  • Biochemical Approaches:

    • Cross-linking: Chemical cross-linkers with varying spacer lengths can trap transient interactions

    • Co-immunoprecipitation: Using differentially tagged receptor variants

    • Blue native PAGE: For analysis of native protein complexes

  • Advanced Microscopy Techniques:

    • Single-molecule microscopy: To track individual receptor movements and interactions

    • STORM/PALM: Super-resolution microscopy to visualize nanoscale organization

    • Fluorescence Correlation Spectroscopy (FCS): To measure diffusion coefficients that change upon oligomerization

  • Functional Assays to Assess Oligomerization Impact:

    • Complementation Assays: Split reporter systems (BiFC, split luciferase)

    • Trans-activation/inhibition studies: Using selective ligands and chimeric receptors

    • Altered pharmacology: Changes in ligand binding or signaling properties when co-expressed with potential partners

How should researchers address the challenge of low expression levels when producing recombinant rabbit ADRA2B?

Low expression levels are a common challenge when producing recombinant GPCRs like rabbit ADRA2B. A systematic troubleshooting approach should include:

  • Expression Vector Optimization:

    • Promoter Selection: For mammalian systems, test CMV, EF1α, and PGK promoters. For baculovirus systems, evaluate ΔIE1 and polh promoters as these have shown success for recombinant protein production .

    • Codon Optimization: Adapt the rabbit ADRA2B sequence to match the codon bias of the expression host.

    • Signal Sequence Modification: Test various signal peptides (e.g., from highly expressed membrane proteins) to improve membrane targeting.

  • Expression Enhancement Strategies:

    • Fusion Partners: N-terminal fusion with well-folded proteins (e.g., maltose-binding protein, thioredoxin)

    • Pharmacological Chaperones: Include receptor-specific ligands in the culture medium to stabilize folding

    • Culture Conditions: Optimize temperature (30-32°C often improves folding), induction timing, and cell density

  • Host Cell Modifications:

    • For insect cell systems, productivity of up to 5 × 10^4 vg/cell has been achieved by using appropriate promoters and expression cassettes .

    • For stable mammalian cell lines, yields can reach up to 5 × 10^5 vg/cell with optimized systems .

    • Consider co-expression of molecular chaperones and modulation of the unfolded protein response

  • Detection Method Sensitivity:

    • Utilize high-sensitivity western blotting with enhanced chemiluminescence

    • Implement fluorescence-based detection systems with appropriate epitope tags

    • Consider radioligand binding with high specific activity ligands to detect functional receptor even at low expression levels

Each modification should be systematically tested and quantitatively evaluated for its impact on both expression level and receptor functionality to avoid optimizing for quantity at the expense of quality.

What approaches help resolve contradictory pharmacological data when comparing rabbit ADRA2B with other species?

When confronted with contradictory pharmacological data between rabbit ADRA2B and other species' orthologs, researchers should implement a systematic investigation:

  • Methodological Standardization:

    • Ensure identical experimental conditions across species comparisons (same buffer systems, temperature, protein:lipid ratios)

    • Use consistent expression systems to minimize system-specific artifacts

    • Implement rigorous quality control to confirm receptor integrity in all preparations

  • Comprehensive Pharmacological Profiling:

    • Test multiple structural classes of ligands rather than single representatives

    • Generate complete concentration-response curves rather than single-point measurements

    • Examine multiple signaling pathways to detect biased signaling differences

  • Structure-Function Relationship Analysis:

    • Identify amino acid differences in the ligand-binding domain between species

    • Create reciprocal mutants to determine if specific residues account for pharmacological differences

    • Utilize molecular docking and dynamics simulations to predict binding mode differences

  • System-Level Considerations:

    • Examine differences in G protein subtypes and expression levels across experimental systems

    • Investigate species-specific differences in receptor regulation (phosphorylation, internalization)

    • Consider the influence of membrane composition on receptor conformation and function

  • Data Integration and Modeling:

    • Apply allosteric modeling to capture complex interactions

    • Develop quantitative structure-activity relationships that incorporate species differences

    • Utilize statistical approaches like principal component analysis to identify patterns in complex datasets

By systematically addressing these aspects, researchers can transform seemingly contradictory findings into valuable insights about species-specific receptor pharmacology and signaling mechanisms.

How can CRISPR/Cas9 genome editing be applied to study rabbit ADRA2B function in native cellular contexts?

CRISPR/Cas9 technology offers powerful approaches to study rabbit ADRA2B in its native context:

  • Precise Genetic Modification Strategies:

    • Knock-in of Reporter Tags: Inserting fluorescent protein or epitope tags at the C-terminus of endogenous ADRA2B enables visualization and purification without overexpression artifacts.

    • Point Mutation Introduction: Creating specific variants (e.g., mimicking human polymorphisms) to study their functional impact.

    • Deletion Variants: Generating the equivalent of human deletion variant that has been associated with emotional memory effects to study comparative phenotypes.

    • Regulatory Element Editing: Modifying promoter/enhancer regions to study transcriptional regulation.

  • Methodological Approach:

    • Design multiple guide RNAs targeting the rabbit ADRA2B locus (Gene ID: 100352237)

    • Optimize homology-directed repair templates including selection markers

    • Screen and validate edited cells using sequencing, western blotting, and functional assays

    • For in vivo studies, apply CRISPR in rabbit embryos followed by embryo transfer

  • Functional Characterization Applications:

    • Signaling Studies: Compare native vs. modified receptor coupling to different G proteins

    • Trafficking Analysis: Track endogenous receptor localization during activation/desensitization

    • Protein Interaction Networks: Identify native interaction partners through proximity labeling

    • Physiological Responses: Measure changes in cellular functions (e.g., neurotransmitter release)

  • Translational Research Applications:

    • Create rabbit models mirroring human ADRA2B variants associated with disease

    • Test compound efficacy in cells with physiological receptor expression levels

    • Study tissue-specific ADRA2B function through conditional knockout strategies

When designing CRISPR experiments, researchers should carefully validate off-target effects and consider the impact of genetic background on phenotypic outcomes.

What are the methodological considerations when developing antibodies specific to rabbit ADRA2B for research applications?

Developing specific antibodies against rabbit ADRA2B requires strategic antigen design and comprehensive validation:

  • Antigen Design Strategy:

    • Peptide Selection: Choose unique, surface-exposed regions of rabbit ADRA2B that differ from other adrenergic receptors. N-terminal domain and third extracellular loop are often good targets.

    • Recombinant Protein Fragments: Express soluble domains (e.g., N-terminal region) fused to carrier proteins.

    • Genetic Immunization: Use DNA encoding rabbit ADRA2B for in vivo expression.

    • Synthetic Antigen Approach: Create mimotopes that represent conformational epitopes without requiring full protein expression.

  • Production Methodologies:

    • Hybridoma Technology: For monoclonal antibody development, with screening against both rabbit ADRA2B and other species' orthologs to assess specificity.

    • Phage Display: To select high-affinity recombinant antibodies or fragments from naive or synthetic libraries.

    • Single B-cell Cloning: For rapid isolation of antigen-specific antibodies following immunization.

  • Critical Validation Steps:

    • Cross-reactivity Testing: Against all three α2-adrenergic receptor subtypes (α2A, α2B, α2C) and across species.

    • Knockout/Knockdown Controls: Using CRISPR-modified cells lacking ADRA2B expression.

    • Application-specific Validation:

      • For Western blotting: Denaturation resistance

      • For immunoprecipitation: Binding under native conditions

      • For immunohistochemistry: Fixation compatibility

      • For flow cytometry: Surface epitope accessibility

  • Technical Considerations:

    • Epitope Tagging: For comparative validation, pair antibody development with cells expressing epitope-tagged ADRA2B

    • Conformation Sensitivity: Determine if antibodies recognize active, inactive, or all receptor states

    • Documentation: Maintain detailed records of validation experiments for reproducibility

Proper antibody development and validation are crucial as non-specific or poorly characterized antibodies can lead to misleading results in ADRA2B research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.