Recombinant Rabbit Anion exchange transporter (SLC26A7)

Shipped with Ice Packs
In Stock

Description

Introduction

The solute carrier family 26 member 7 (SLC26A7) is an anion transporter that is part of the SLC26 gene family . SLC26A7 has been found in the stomach, kidney, inner ear, and thyroid . Research indicates its involvement in chloride ion (Cl-) exchange and transport of iodide .

Tissue Localization and Expression

SLC26A7 is highly expressed in the mouse retinal pigment epithelium (RPE) and localized to the basolateral membrane . Studies using isolated wild-type mouse RPE cells showed that SLC26A7 is predominantly expressed in the basolateral membrane .

Functional Studies and Research Findings

Studies show that deletion of Slc26a7 significantly reduces the conductance and relative permeability for SCN− in intact RPE cells and excised basolateral membrane patches . This identifies SLC26A7 as the origin of the SCN−-selective anion conductance of the RPE basolateral membrane .

Thyroid Function:
Slc26a7 −/− mice had goiters and significantly higher thyroid weights than wild-type mice, and the characteristic follicular structure was lost in the thyroid glands of Slc26a7 −/− mice (Fig. 1d,e,f) . Serum FT4 levels were significantly lower and serum TSH levels were significantly higher in Slc26a7 −/− mice than in wild-type mice (Fig. 2a,b) .

The mean normalized outward conductance in the presence of 10 mM SCN − was 92.4% smaller in Slc26a7 KO mouse RPE cells [0.095 ± 0.010 nS/pF, n = 19] than in WT mouse RPE cells [0.996 ± 0.106 nS/pF, n = 16; P < 0.0001, 2-tailed unpaired t test] .

SLC26A7 and Anion Selectivity

SLC26A7 contributes to the whole-cell SCN− conductance in RPE cells exposed to 140 mM or 10 mM external SCN− . The relative permeability of SCN− over Cl− (P SCN/P Cl) was significantly higher in wild-type mouse RPE cells compared to Slc26a7 KO mouse RPE cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SLC26A7; Anion exchange transporter; Solute carrier family 26 member 7; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
SLC26A7
Target Protein Sequence
LFSFKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPRGIPPPRAP PMNILSAVITEAFGVALVGYAASLALAQGSAKKFKYSVDDNQEFLAHGLSNVISSFLFCI PSAAAMGR
Uniprot No.

Target Background

Function

Recombinant Rabbit Anion exchange transporter (SLC26A7) functions as a sodium-independent, DIDS-sensitive anion exchanger, facilitating the transport of bicarbonate, chloride, sulfate, and oxalate. It contributes to electrolyte and acid-base homeostasis in the kidney, specifically acting as an anion exchanger in the distal excretory segment. It also plays a crucial role in gastric acid secretion.

Database Links
Protein Families
SLC26A/SulP transporter (TC 2.A.53) family
Subcellular Location
Recycling endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in gastric epithelium, predominantly in the gastric parietal cells but also at lower levels in mucosal cells.

Q&A

What is SLC26A7 and what are its primary physiological functions?

SLC26A7 functions as a sodium-independent anion exchanger/channel that mediates the transport of multiple anions including chloride, bicarbonate, sulfate, oxalate, and notably, iodide and thiocyanate. Physiologically, SLC26A7 plays crucial roles in:

  • Maintenance of electrolyte and acid-base homeostasis in kidney tissues

  • Gastric acid secretion processes

  • Iodide transport in thyroid follicular cells, essential for thyroid hormone synthesis

  • Anion conductance in specialized epithelial cells such as the retinal pigment epithelium

  • pH regulation in various tissues

The protein demonstrates tissue-specific localization patterns and functions as both an exchanger and channel depending on cellular context.

How does SLC26A7 differ from other members of the SLC26 family?

SLC26A7 belongs to the solute carrier family 26, but exhibits unique characteristics:

  • Demonstrates particularly high thiocyanate (SCN-) selectivity compared to other family members, especially in retinal tissues

  • Serves as a complementary iodide transporter to SLC26A4 (pendrin) in thyroid tissue, with studies showing SLC26A7 more strongly influences thyroid function

  • Shows distinct expression patterns across tissues with high expression in thyroid, kidney, stomach, and retinal pigment epithelium

  • Functions independently of sodium, unlike some other ion transporters

Research also indicates SLC26A7 can functionally replace SLC26A4 when the latter is not functioning properly, particularly in iodide transport into the thyroid follicular lumen .

What techniques are most effective for detecting SLC26A7 protein expression?

Multiple complementary approaches are recommended for robust detection:

TechniqueApplicationDetection ParametersRecommended Controls
Western BlotProtein expression quantification1:1000-1:2000 dilutionKidney/stomach tissues as positive controls
ImmunofluorescenceSpatial localizationPolyclonal antibodiesComparison with knockout tissues
qRT-PCRmRNA expressionRelative to housekeeping genesMultiple reference genes
ELISAQuantitative protein detectionSLC26A7-specific antibodiesStandard curve verification

When working with recombinant rabbit SLC26A7, it's critical to ensure antibody specificity as the commercially available rabbit polyclonal antibody shows reactivity with human, mouse and rat proteins, confirming conservation across species but potentially complicating detection in rabbit tissues .

What is the subcellular localization pattern of SLC26A7 in different tissues?

SLC26A7 shows distinct membrane targeting depending on the cell type:

  • In thyroid follicular cells: primarily apical membrane localization, allowing iodide transport into follicular lumen

  • In renal tissues: basolateral membrane expression, facilitating chloride and bicarbonate exchange

  • In Reissner's membrane epithelial cells: basolateral membrane with expression onset at postnatal day 5 (P5)

  • In retinal pigment epithelium (RPE): basolateral membrane localization, contributing to SCN- transport

Notably, mutations in SLC26A7 can disrupt proper membrane targeting, as seen in congenital hypothyroidism cases where mutated protein shows abnormal cytoplasmic localization rather than membrane integration .

How can researchers effectively measure SLC26A7 transport activity?

The following methodologies have proven effective:

  • Whole-cell patch clamp recording: Essential for measuring ion conductance and selectivity. This approach has demonstrated that SLC26A7 channels show elevated conductance for NO3- over Cl- and are inhibited by I- and NPPB

  • Excised patch recordings: Useful for measuring direct channel activity in native membrane contexts

  • Anion substitution experiments: Replace Cl- with other anions (e.g., SCN-, NO3-) to identify selective conductance properties

  • Expression in heterologous systems: Transfection of SLC26A7 into model cell lines followed by transport assays can isolate its function from other transporters

When designing these experiments, researchers should include proper controls such as measurements in tissues/cells from SLC26A7 knockout models to distinguish SLC26A7-specific activity from other anion transporters.

What are the unique ion selectivity properties of SLC26A7?

SLC26A7 demonstrates distinctive anion selectivity that varies by tissue:

  • In retinal pigment epithelium: Highly selective for thiocyanate (SCN-), with SCN- conductance 92.4% lower in SLC26A7 knockout mouse RPE cells compared to wild-type

  • In Reissner's membrane: Shows elevated conductance for NO3- over Cl- with inhibition by I- and NPPB

  • In thyroid cells: Functions as an iodide transporter, particularly important in low iodine environments

  • In renal and gastric tissues: Mediates bicarbonate, chloride, sulfate and oxalate transport

These tissue-specific variations in selectivity likely reflect differing physiological requirements and potentially differential regulation or post-translational modifications.

How does SLC26A7 dysfunction contribute to thyroid disorders?

SLC26A7 plays a critical role in thyroid function:

  • Congenital hypothyroidism: Homozygous nonsense mutations in SLC26A7 (e.g., c.1498 C>T; p.Gln500Ter) have been identified in patients with congenital goitrous hypothyroidism

  • Thyroid cancer: SLC26A7 expression is significantly downregulated in high-grade papillary thyroid carcinoma (PTC HG) and anaplastic thyroid carcinoma

  • Metastatic potential: In papillary thyroid carcinoma, SLC26A7 downregulation correlates with elevated risk of metastases outside the thyroid

SLC26A7 knockout mice exhibit:

  • Goitrous congenital hypothyroidism and mild growth failure on normal diets

  • Marked growth failure in low iodine environments

  • More severe impairment than SLC26A4 knockout mice under similar conditions

This evidence establishes SLC26A7 as more strongly involved in iodide transport and maintenance of thyroid function than the previously characterized SLC26A4.

What is the diagnostic value of SLC26A7 in thyroid cancer?

SLC26A7 shows promising utility as a diagnostic marker:

  • In high-grade papillary thyroid carcinoma (PTC HG), SLC26A7 demonstrates the largest area under the ROC curve (0.816) in differentiating between PTC and PTC HG

  • As a standalone marker, SLC26A7 provides 54% sensitivity and 87.6% specificity in identifying PTC HG

  • When combined with other markers (CPQ, miR-21, and mtDNA) in a decision tree algorithm, specificity increases to 100% while maintaining 54% sensitivity

Diagnostic CharacteristicsDecision TreeSLC26A7 Alone
Sensitivity53.8% (25.1–80.8%)53.8% (25.1–80.8%)
Specificity100.0% (96.3–100.0%)87.6% (79.4–93.4%)
Accuracy94.5% (88.5–97.8%)83.6% (75.5–90.0%)
Positive predictive value100.0% (59.0–100.0%)36.8% (36.8–54.8%)
Negative predictive value94.2% (90.0–96.7%)93.4% (88.7–96.2%)

These findings support the potential use of SLC26A7 in preoperative diagnosis to guide surgical planning and post-operative management decisions .

How do SLC26A7 and SLC26A4 functionally interact in thyroid iodide transport?

Research on the relationship between these transporters reveals:

  • SLC26A7 can functionally replace SLC26A4 (pendrin) when the latter is not functioning properly, providing redundancy in iodide transport systems

  • Double-knockout mice (SLC26A7-/- and SLC26A4-/-) show more severe growth failure than single SLC26A7-/- mice, indicating some complementary functions

  • RNA-seq analysis shows significantly more differentially expressed genes in SLC26A7-/- mice compared to SLC26A4-/- mice, suggesting broader transcriptional effects

  • While SLC26A4 is known to be localized at the apical membrane of thyrocytes, functional studies indicate SLC26A7 plays a stronger role in iodide transport and maintenance of thyroid function

This complementary but distinct functioning explains why patients with Pendred syndrome (SLC26A4 mutations) often maintain relatively normal thyroid hormone levels, as SLC26A7 can partially compensate for the loss of pendrin function .

What are the optimal experimental conditions for studying recombinant rabbit SLC26A7?

When working with recombinant rabbit SLC26A7:

  • Protein detection: Western blot analysis should use antibody dilutions of 1:1000-1:2000, with kidney and stomach tissues as positive controls

  • Expression systems: Mammalian expression systems (rather than bacterial) are recommended to ensure proper post-translational modifications and membrane targeting

  • Functional assays: Whole-cell patch clamp recordings with sequential anion substitution provide clear measurements of transport specificity

  • Verification: Confirm membrane localization through immunofluorescence microscopy before functional studies to ensure proper trafficking

  • Quality control: Verify protein integrity using ELISA techniques that are sensitive and specific for rabbit SLC26A7 with no significant cross-reactivity to analogues

When designing knockout or knockdown experiments, researchers should be aware that compensatory mechanisms involving other anion transporters may emerge, potentially complicating interpretation of results.

What are the unresolved questions regarding SLC26A7's physiological roles?

Several critical knowledge gaps remain:

  • The precise regulatory mechanisms controlling SLC26A7 expression across different tissues remain poorly characterized

  • The complete interactome of SLC26A7 with other membrane proteins and cytosolic factors is not fully mapped

  • The potential role of SLC26A7 in responding to pH perturbations in Reissner's membrane cells requires further investigation

  • The contribution of SLC26A7 to electrophysiological properties of tissues beyond thyroid, kidney and retina remains underexplored

  • Whether pharmacological modulation of SLC26A7 could provide therapeutic benefit in conditions like hypothyroidism needs evaluation

These knowledge gaps present opportunities for researchers to advance understanding of this important transporter.

How can inconsistencies in SLC26A7 function across species and experimental systems be reconciled?

Researchers face several challenges when comparing SLC26A7 studies:

  • Different experimental approaches (whole-cell vs. excised patch recordings) may yield varying results regarding ion selectivity and conductance properties

  • Species differences in SLC26A7 sequence and regulation may lead to functional variations between human, mouse, and rabbit orthologues

  • The cellular environment significantly impacts SLC26A7 function, with heterologous expression systems potentially lacking critical cofactors or regulatory mechanisms

  • Post-translational modifications may vary across tissues and experimental conditions

To address these challenges, researchers should:

  • Directly compare multiple species' SLC26A7 in identical experimental systems

  • Utilize native tissue preparations whenever possible

  • Employ complementary methodologies to build consensus on functional properties

  • Consider the cellular and physiological context when interpreting results

What novel therapeutic applications might emerge from SLC26A7 research?

Based on current knowledge, several potential therapeutic applications warrant investigation:

  • Development of SLC26A7 activators for patients with congenital hypothyroidism caused by partial loss-of-function mutations

  • Creation of diagnostic tools for early detection of high-grade thyroid carcinomas based on SLC26A7 expression levels

  • Exploration of SLC26A7's role in retinal diseases and potential therapeutic targeting

  • Investigation of SLC26A7 modulation as an approach to correcting acid-base disorders in renal pathologies

The discovery that SLC26A7 plays a greater role in thyroid function than previously recognized transporters opens new possibilities for targeting thyroid disorders through this pathway .

What emerging technologies might advance SLC26A7 research?

Several cutting-edge approaches show promise:

  • CRISPR-based genome editing for precise modification of SLC26A7 in model organisms and cell lines

  • Advanced imaging techniques like super-resolution microscopy to better visualize membrane localization and dynamics

  • Single-cell transcriptomics to reveal cell-specific expression patterns within heterogeneous tissues

  • Cryo-EM structural biology approaches to determine the three-dimensional structure of SLC26A7 and its conformational changes during transport

  • Computational modeling to predict ion binding sites and design selective modulators

Integration of these technologies will likely accelerate understanding of SLC26A7's structure-function relationships and physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.