Recombinant Rabbit Aquaporin-2 (AQP2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

AQP2 is a 271-amino-acid transmembrane protein (28.8 kDa) with six membrane-spanning domains and two NH₂-terminal repeats . It forms tetramers to mediate water transport across cell membranes. Key functional features include:

  • Vasopressin Regulation: AVP binding to V2 receptors triggers cAMP signaling, promoting AQP2 phosphorylation (e.g., Ser256, Ser264) and translocation to the apical membrane of renal principal cells .

  • Post-Translational Modifications: Phosphorylation at Ser261 and Ser264 modulates AQP2 stability and trafficking .

Recombinant Production

Recombinant AQP2 is typically expressed in E. coli or mammalian systems for structural and functional studies. Key details from available recombinant proteins include:

ParameterValueSource
Expression SystemE. coli (e.g., rat AQP2)
TagN-terminal 10xHis-tag (rat AQP2)
Purity>85% (SDS-PAGE)
Molecular Weight~30.4 kDa (rat recombinant)

Note: Recombinant rabbit AQP2 is not documented in available literature. Most studies use rat or human AQP2.

Post-Translational Modifications

Phosphorylation sites critical for AQP2 function include:

SiteRegulationFunctionSource
Ser256PKA-dependent phosphorylationTrafficking to apical membrane
Ser264AVP-responsive phosphorylationEndosomal recycling and stability

Phosphorylation at Ser261 is linked to reduced polyubiquitination and proteasomal degradation .

Research Applications

Recombinant AQP2 is used to study:

  • Trafficking Pathways: Proteomic analysis of AQP2-containing vesicles reveals associations with Rab GTPases (endosomes) and myosin motors .

  • Endocytosis: Ezrin, an ERM protein, binds AQP2’s C-terminus via its FERM domain, promoting endocytosis .

  • Membrane Dynamics: AQP2 localizes to clathrin-coated pits and early endosomes post-vasopressin stimulation .

Table 1: Recombinant AQP2 Expression Characteristics

SpeciesExpression SystemTagKey Applications
RatE. coliN-terminal HisStructural studies, binding assays
HumanMammalian cellsNativePhosphorylation studies

Table 2: Phosphorylation Sites and Functions

SiteKinaseEffect of PhosphorylationSource
Ser256PKAApical membrane translocation
Ser264PKAEndosomal recycling, stability

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
AQP2
Target Protein Sequence
SIAFSRAVFAEFLATLLFVFFGLGSALNWPSALPSTLQIAMAFGLGIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEITPAEVRG
Uniprot No.

Target Background

Function
Aquaporin-2 (AQP2) forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water. This allows water to move along osmotic gradients, contributing to the regulation of water balance in the body.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Aquaporin-2 and what is its physiological role?

Aquaporin-2 (AQP2) is a water-specific channel protein that provides renal collecting duct plasma membranes with high water permeability. It permits water to move in the direction of osmotic gradients and plays an essential role in renal water homeostasis . AQP2 functions as the primary vasopressin-regulated water channel in the kidney collecting duct. Some evidence suggests it may also be permeable to glycerol, though its primary function remains water transport . AQP2 is also known by several alternative names including AQP-2, ADH water channel, Aquaporin-CD, Collecting duct water channel protein (WCH-CD), and Water channel protein for renal collecting duct (AQP-CD) .

How is AQP2 regulated in vivo?

AQP2 is primarily regulated by arginine vasopressin (AVP), which controls its abundance in the apical membrane of collecting duct principal cells. The regulatory mechanism involves several steps: (1) AVP activates V2 receptors in the basolateral membrane; (2) this stimulates adenylyl cyclase, increasing intracellular cAMP levels; (3) elevated cAMP results in phosphorylation of AQP2; (4) phosphorylated AQP2 rapidly traffics from subapical storage vesicles to the apical membrane; (5) concurrently, AVP reduces endocytosis of AQP2 . Prolonged exposure to AVP (over several days) additionally stimulates AQP2 gene transcription, further increasing its abundance .

What happens when AQP2 function is dysregulated?

Dysregulation of AQP2 synthesis or membrane abundance significantly affects fluid balance. Insufficient AQP2 function contributes to cranial or nephrogenic diabetes insipidus, causing excessive water loss and hypernatremia . Conversely, increased apical membrane abundance of AQP2 contributes to enhanced water retention and hyponatremia in conditions such as congestive heart failure, liver cirrhosis, or syndrome of inappropriate ADH secretion . Mutations in the AQP2 gene can cause hereditary nephrogenic diabetes insipidus in humans .

What are the key phosphorylation sites on AQP2?

Two key phosphorylation sites on AQP2 have been identified as critical for its function:

  • Serine-256: Vasopressin-induced cAMP increases result in phosphorylation at this site, triggering AQP2 translocation from intracellular vesicles to the apical membrane of principal cells .

  • Serine-269: More recently identified as a vasopressin-mediated phosphorylation site on AQP2, though its specific role is still being investigated .

These phosphorylation events are essential for proper trafficking and function of AQP2 in response to hormonal stimulation.

How do extracellular nucleotides modulate AQP2 regulation via P2 receptors?

Extracellular nucleotides modulate vasopressin-regulated water reabsorption in the collecting duct through P2 receptors (P2R). In vitro studies using mouse collecting duct (mpkCCD) cells have revealed that AVP can alter P2R abundance and localization, and activation of apically and basolaterally localized P2R can cause internalization and degradation of AQP2 .

Specifically, vasopressin-induced AQP2 localization to the apical membrane can be counteracted by ATP, which causes AQP2 internalization. Different P2R subtypes play specific roles:

  • P2Y₁ and P2Y₄ receptors localize to the apical membrane independently of vasopressin presence.

  • Vasopressin induces cAMP-dependent synthesis and apical localization of both AQP2 and the P2X₁ receptor.

  • Vasopressin induces translocation of P2X₂ and P2Y₂ receptors to the apical and basolateral membranes, respectively.

  • Activation of basolaterally localized P2Y₂ receptors and apically localized P2X₂ and P2Y₄ receptors stimulates AQP2 internalization even in the presence of vasopressin .

This complex regulatory relationship between apical and basolateral P2R significantly impacts AVP-stimulated, AQP2-mediated water transport in the collecting duct.

What is the mechanism of P2R-mediated inhibition of AQP2 function?

P2R-mediated inhibition of AQP2 function operates through several mechanisms:

  • The P2Y₂ receptor in the basolateral membrane inhibits AVP-stimulated water transport through a PKC-dependent pathway.

  • This inhibition results from decreased intracellular cAMP and increased PGE₂ levels .

  • Co-expression experiments in Xenopus oocytes demonstrated that P2R activation decreased membrane AQP2 and AQP2-mediated water permeability specifically in oocytes expressing P2X₂, P2Y₂, or P2Y₄ receptors, but not other P2R subtypes .

  • The reduction in AQP2-mediated water permeability is associated with removal of AQP2 protein from the plasma membrane, as confirmed by immunoblot analysis of plasma membrane fractions .

These findings indicate that both apical and basolateral nucleotides can regulate AQP2 function through specific P2R subtypes, providing a complex layer of regulation beyond the classical vasopressin pathway.

What are the differences between various AQP2 protein isoforms and their functional significance?

While the search results don't directly address different AQP2 isoforms, the data suggests potential post-translational modifications and functional variants:

  • Differential phosphorylation states: AQP2 can be phosphorylated at multiple sites including Serine-256 and Serine-269, which influence its trafficking and membrane localization .

  • Observed band size variations: Western blot analysis of AQP2 antibodies shows both predicted band sizes of 29 kDa and observed band sizes of 39 kDa , suggesting post-translational modifications (glycosylation, ubiquitination) may alter the apparent molecular weight of AQP2 in experimental settings.

These modifications likely contribute to functional differences in AQP2, including its trafficking, stability at the membrane, and interaction with regulatory proteins.

What are the optimal methods for detecting AQP2 in experimental systems?

Several methodological approaches are effective for detecting AQP2 in experimental systems:

  • Western Blotting (WB):

    • Recommended dilution: 1/1000 for recombinant antibodies

    • Sample preparation: Cell/tissue lysates (20 μg per lane)

    • Secondary antibody: Anti-Rabbit IgG H&L (HRP) at 1/20000 dilution

    • Expected results: Predicted band size around 29 kDa, though observed band size may appear at 39 kDa due to post-translational modifications

    • Exposure time: ~40 seconds is typically sufficient

  • Immunohistochemistry (IHC) and Immunocytochemistry (ICC):

    • Several antibodies are suitable for IHC-P (paraffin-embedded tissues), IHC-Fr (frozen sections), and ICC/IF applications

    • Both polyclonal and monoclonal antibodies are available, with monoclonal options providing greater specificity

  • Immunoprecipitation (IP):

    • Specific antibodies are validated for IP applications to study AQP2 interactions

  • Multiplex Immunohistochemistry (mIHC):

    • Advanced applications for studying AQP2 in the context of other proteins

The selection of detection method should be based on the specific research question and experimental system.

How should researchers design experiments to study AQP2 trafficking?

For studying AQP2 trafficking, researchers should consider the following experimental design approaches:

  • Cell Culture Models:

    • mpkCCD cells provide an excellent model system as they demonstrate vasopressin-induced AQP2 trafficking similar to native collecting duct cells

    • Treatment with dDAVP (a vasopressin analog) induces AQP2 localization to the apical membrane

  • Trafficking Visualization:

    • Immunofluorescence microscopy with antibodies specific to AQP2 can track its subcellular localization

    • Time-course experiments to capture the dynamic process of trafficking from intracellular vesicles to the membrane

  • Pharmacological Interventions:

    • Use of ATP (10 μM) to study P2R-mediated internalization of AQP2

    • PKC modulation to investigate the signaling pathway of AQP2 trafficking

  • Heterologous Expression Systems:

    • Xenopus oocytes co-expressing AQP2 with various P2R subtypes provide a controlled system to study receptor-specific effects on AQP2 trafficking

    • Cell swelling assays measure functional water permeability changes associated with trafficking

  • Membrane Fractionation:

    • Separation of total membrane and plasma membrane fractions followed by immunoblot analysis to quantify changes in surface expression of AQP2

These approaches can be combined to comprehensively characterize AQP2 trafficking under various physiological and pathological conditions.

What control conditions are essential when studying recombinant rabbit AQP2?

When designing experiments with recombinant rabbit AQP2, several control conditions should be included:

  • Antibody Specificity Controls:

    • Negative controls: Samples known not to express AQP2

    • Peptide competition assays: Pre-incubation of antibody with immunizing peptide should abolish specific staining

    • Species cross-reactivity: Verify specificity across species if working with human, mouse, or rat samples in addition to rabbit

  • Physiological Response Controls:

    • Basal conditions (absence of vasopressin/dDAVP) to establish baseline AQP2 localization

    • Positive control: Treatment with dDAVP to induce AQP2 translocation to the apical membrane

    • Negative control: Co-treatment with ATP to internalize AQP2

  • Receptor Specificity Controls:

    • When studying P2R-mediated effects, include controls for each receptor subtype

    • In oocyte expression systems, include oocytes expressing AQP2 alone without P2R co-expression

  • Phosphorylation-Specific Controls:

    • Phosphatase treatment to remove phosphorylation modifications

    • Site-directed mutagenesis of key phosphorylation sites (S256A, S269A) to validate phosphorylation-specific antibodies

These controls ensure experimental rigor and help distinguish specific AQP2-related effects from background or non-specific responses.

How can researchers effectively study the interaction between AQP2 and regulatory proteins?

To study interactions between AQP2 and its regulatory proteins, researchers should consider these methodological approaches:

  • Co-Immunoprecipitation (Co-IP):

    • Use antibodies against AQP2 to pull down protein complexes

    • Analyze co-precipitated proteins by immunoblotting or mass spectrometry

    • Include appropriate negative controls (non-specific IgG, lysates from cells not expressing AQP2)

  • Proximity Ligation Assay (PLA):

    • Detect protein-protein interactions in situ with subcellular resolution

    • Particularly useful for detecting transient interactions during trafficking

  • Heterologous Expression Systems:

    • Co-expression of AQP2 with potential interacting proteins in Xenopus oocytes or mammalian cell lines

    • Functional readouts (water permeability) combined with trafficking assessments

  • FRET/BRET Approaches:

    • Fusion of fluorescent/bioluminescent tags to AQP2 and potential interacting partners

    • Real-time monitoring of protein interactions in living cells

  • Cross-linking Studies:

    • Chemical cross-linking followed by immunoprecipitation and mass spectrometry

    • Helps capture transient interactions in the native cellular environment

These approaches should be combined with functional assays to correlate protein interactions with physiological outcomes such as water permeability and AQP2 trafficking.

How can researchers interpret discrepancies in AQP2 molecular weight across different experimental systems?

AQP2 typically has a predicted molecular weight of approximately 29 kDa, but observed band sizes in immunoblots may vary, with reports showing bands at 39 kDa . These discrepancies can be interpreted by considering:

  • Post-translational Modifications:

    • Glycosylation can significantly increase apparent molecular weight

    • Phosphorylation (at sites like Ser256 and Ser269) adds minimal weight but may alter protein migration

    • Ubiquitination (+8.5 kDa per ubiquitin molecule) involved in AQP2 endocytosis

  • Protein Aggregation:

    • AQP2 forms tetramers in membranes; incomplete denaturation may result in oligomeric forms

    • Sample preparation conditions (detergent, reducing agents, temperature) significantly impact observed molecular weight

  • Splice Variants:

    • Different isoforms may exist across species or cell types

    • Verify using transcript analysis or N- and C-terminal antibodies

When troubleshooting molecular weight discrepancies, researchers should:

  • Test multiple antibodies targeting different epitopes

  • Optimize sample preparation conditions

  • Include positive controls with known molecular weight

  • Consider deglycosylation treatments to remove glycan contributions to molecular weight

These approaches help differentiate true biological variation from technical artifacts in AQP2 detection.

What are the common pitfalls in P2R-AQP2 regulatory studies and how can they be addressed?

Studies of P2R-mediated regulation of AQP2 face several common pitfalls that can be addressed through careful experimental design:

  • Receptor Specificity Challenges:

    • Pitfall: Truly specific agonists for P2R subtypes are not available

    • Solution: Use molecular approaches (siRNA, CRISPR) to complement pharmacological profiling

    • Approach: Heterologous expression systems with defined receptor expression

  • Temporal Dynamics Considerations:

    • Pitfall: Short-term vs. long-term effects may involve different mechanisms

    • Solution: Design time-course experiments (minutes to days)

    • Evidence: AVP increases P2Y₂ mRNA and protein levels after 90 minutes of infusion

  • Cell-Type Specific Responses:

    • Pitfall: Extrapolating findings between different experimental models

    • Solution: Validate key findings across multiple systems (cell lines, primary cells, in vivo models)

    • Consideration: mpkCCD cells provide a good model but may not replicate all aspects of native collecting duct cells

  • Signal Crosstalk:

    • Pitfall: P2R activation affects multiple signaling pathways beyond AQP2

    • Solution: Use pathway-specific inhibitors to dissect mechanisms

    • Example: PKC-dependent inhibition affects cAMP levels and PGE₂ production

  • Physiological Relevance:

    • Pitfall: Concentration of nucleotides used experimentally may not match physiological levels

    • Solution: Include dose-response experiments and measure endogenous nucleotide levels

    • Consideration: P2Y₂ knockout mice exhibit higher AQP2 levels compared to wild-type despite similar AVP levels

Addressing these pitfalls through rigorous experimental design and appropriate controls strengthens the validity and physiological relevance of findings in P2R-AQP2 regulatory studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.