Recombinant Rabbit Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Shipped with Ice Packs
In Stock

Description

Functional Role in Leukotriene Biosynthesis

ALOX5AP is essential for converting arachidonic acid into pro-inflammatory leukotrienes (e.g., LTB4, LTC4) . Key mechanisms include:

  • Substrate Binding: Direct interaction with arachidonic acid and inhibitors like MK-886 .

  • Enzyme Activation: Membrane localization of ALOX5, enhancing its catalytic activity .

  • Pathway Involvement: Central to the Synthesis of Leukotrienes and Eoxins pathway .

Research Applications

Recombinant Rabbit ALOX5AP is utilized in:

  • Inflammation Studies: Modeling leukotriene-driven conditions (e.g., asthma, arthritis) .

  • Drug Development: Screening inhibitors targeting the ALOX5AP-ALOX5 complex .

  • Immune Response Analysis: Investigating B-cell and T-cell interactions in adaptive immunity .

Key Research Findings

  • Genetic Links: ALOX5AP haplotypes correlate with coronary heart disease risk in hypercholesterolemia patients, emphasizing its inflammatory role .

  • Neurodegeneration: FLAP (ALOX5AP) inhibition reduces amyloid-beta and tau pathology in Alzheimer’s disease models .

  • Adipose Tissue Regulation: ALOX5AP modulates free fatty acid uptake and pro-inflammatory adipokine secretion .

Technical Considerations

  • Stability: Avoid repeated freeze-thaw cycles; aliquot for short-term use .

  • Activity Assays: Requires co-expression with ALOX5 for full leukotriene synthesis .

  • Species Specificity: Rabbit-derived ALOX5AP enables cross-species comparative studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form exhibits a 6-month shelf life at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ALOX5AP; FLAP; Arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MDQEAVGNVVLLAIVTLISVVQNGFFAHKVEHESRNQNGRSFQRTGTLAFERVYTANQNC VDAYPTFLAVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSLAGILNYCLILLFGSDFENYIKTISTT
Uniprot No.

Target Background

Function
Essential for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). It anchors ALOX5 to the membrane. Binds arachidonic acid, potentially playing a crucial role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that inhibits the biosynthesis of leukotrienes.
Database Links
Protein Families
MAPEG family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ALOX5AP and what is its basic function in cellular processes?

Arachidonate 5-lipoxygenase-activating protein (ALOX5AP) is a crucial cofactor required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). The human version of ALOX5AP has a canonical amino acid length of 161 residues and a protein mass of 18.2 kilodaltons. It is predominantly localized in the nucleus and endoplasmic reticulum (ER) of cells, with notable expression in lymph nodes, lungs, cerebral cortex, cerebellum, and bone marrow. ALOX5AP is a member of the MAPEG protein family . Its primary functions include potentiating ALOX5 catalysis and anchoring the complexed ALOX5/ALOX5AP to the nuclear membrane, which is essential for effective leukotriene synthesis .

How does ALOX5AP interact with ALOX5 at the molecular level?

ALOX5AP forms a molecular complex with ALOX5 that occurs at distances less than 30 nm, as demonstrated by fluorescence resonance energy transfer (FRET) studies. This close association is critical for facilitating leukotriene synthesis. ALOX5AP serves two primary functions in this interaction: (1) acting as a protein anchor that localizes ALOX5 to the nuclear membrane, and (2) functioning as a non-enzymatic carrier for arachidonic acid (AA). The ALOX5/ALOX5AP complex has been shown to interact with membrane-bound LTC4-synthase (LTC4-S), resulting in localized cysteinyl leukotriene synthesis . This molecular association primarily occurs in the perinuclear domain but has also been detected in cytoplasmic and nuclear compartments in some experimental conditions .

What expression patterns of ALOX5AP have been observed during normal hematopoiesis?

Analysis of ALOX5AP expression during hematopoiesis reveals a distinct pattern. ALOX5AP transcripts are present at low levels in hematopoietic stem cells from bone marrow (BM HSCs), followed by a sharp increase in committed progenitors, including common myeloid progenitor (CMP) and granulo-monocyte progenitor (GMP) cells. After this increase, ALOX5AP expression remains at high and stable levels throughout myeloid maturation . This expression pattern suggests ALOX5AP plays an important role in myeloid differentiation and function, which may have implications for hematological disorders.

What techniques are most effective for studying ALOX5AP and ALOX5 interactions in tissue samples?

Fluorescence Resonance Energy Transfer (FRET) microscopy has proven to be particularly effective for studying ALOX5AP-ALOX5 interactions. The experimental protocol involves:

  • Fixing and permeabilizing tissue sections with 70% acetone and 30% methanol for 10 minutes at -20°C

  • Blocking with 10% normal donkey serum in PBS for 1 hour

  • Incubating overnight at 4°C with primary antibodies for ALOX5 (mouse anti-ALOX5) and ALOX5AP (rabbit anti-ALOX5AP) in PBS with 1% BSA

  • Incubating with species-specific fluorescent secondary antibodies (donkey anti-mouse Alexa Fluor-555 and donkey anti-rabbit Alexa Fluor-488)

  • Using Alexa Fluor-633 conjugated wheat germ agglutinin to visualize membrane glycoproteins

  • Staining nuclei with DAPI

  • Capturing images at 63x magnification as Z-stacks in 0.2 μm intervals

  • Processing with constrained iterative deconvolution and Gaussian noise smoothing

  • Partitioning cellular structures into cytosolic, perinuclear, and nuclear domains

  • Correcting FRET signal for trans-channel bleed-through and normalizing to acceptor/donor fluorescence voxel intensity

This approach allows for precise quantification of ALOX5-ALOX5AP interactions in different cellular compartments.

What methods are recommended for analyzing ALOX5AP expression levels in patient samples?

Based on current research practices, multiple complementary methods are recommended for analyzing ALOX5AP expression:

  • Real-time quantitative PCR (RQ-PCR): This method is effective for quantifying ALOX5AP mRNA expression levels in bone marrow or tissue samples. Studies have successfully used this technique to analyze expression in de novo acute myeloid leukemia (AML) patients compared to healthy donors .

  • Targeted bisulfite sequencing: This approach is valuable for analyzing ALOX5AP methylation levels, which may correlate with expression patterns .

  • Bioinformatic analysis of public databases: Leveraging datasets from TCGA, GEO, TIMER, and other public repositories can provide comprehensive insights into ALOX5AP expression across different tissues and disease states. Databases such as BloodSpot and HemaExplorer are particularly useful for analyzing expression patterns in hematopoietic cells .

  • Immunostaining with fluorescent antibodies: This method allows for visualization and quantification of ALOX5AP protein levels in tissue sections, as used in trauma and hemorrhagic shock research .

A multi-method approach combining these techniques provides the most comprehensive assessment of ALOX5AP expression.

How should researchers design experiments to investigate ALOX5AP inhibition?

When designing experiments to investigate ALOX5AP inhibition, researchers should consider the following approach:

  • Selection of appropriate inhibitor: MK-886 has been established as an effective ALOX5AP inhibitor in experimental models .

  • In vivo model selection: Animal models that reflect the pathological condition of interest, such as trauma and hemorrhagic shock (T/HS) models for studying lung injury, provide relevant biological contexts .

  • Control groups: Include both positive controls (disease model without inhibitor) and negative controls (sham procedures or healthy controls) .

  • Dose-response relationships: Test multiple doses of the inhibitor to establish effective concentration ranges.

  • Timing of administration: Consider both prophylactic (pre-injury) and therapeutic (post-injury) administration to assess preventive and treatment potential.

  • Measurement of multiple endpoints:

    • ALOX5/ALOX5AP complex formation using FRET microscopy

    • Leukotriene production using appropriate assays

    • Tissue injury assessment through histological analysis

    • Functional parameters relevant to the disease model

    • Molecular markers of inflammation and tissue damage

  • Mechanistic validation: Confirm that the observed effects are specifically due to ALOX5AP inhibition rather than off-target effects.

This comprehensive experimental design allows for robust evaluation of ALOX5AP inhibition strategies and their therapeutic potential.

What is the role of ALOX5AP in acute myeloid leukemia (AML) pathogenesis and prognosis?

ALOX5AP has emerged as a significant prognostic indicator in AML. Research has revealed several key aspects of ALOX5AP's role in AML:

These findings suggest that ALOX5AP may play a crucial role in AML pathogenesis and could serve as a valuable prognostic marker for risk stratification in AML patients.

How does the ALOX5/ALOX5AP complex contribute to post-traumatic lung injury?

The ALOX5/ALOX5AP complex plays a critical role in the development of post-traumatic lung injury through several mechanisms:

  • Leukotriene production: Following trauma and hemorrhagic shock (T/HS), ALOX5 levels increase and ALOX5/ALOX5AP association occurs, leading to enhanced leukotriene synthesis. This has been demonstrated by increases in total tissue fluorescence and FRET signal intensity .

  • Inflammatory cascade: The increased leukotriene production triggers an inflammatory cascade that contributes to lung tissue damage. Post-shock mesenteric lymph contains free arachidonic acid (AA) that activates the leukotriene biosynthetic pathway .

  • Nuclear localization: The ALOX5/ALOX5AP complex localizes to the nuclear membrane, creating a concentrated area of leukotriene synthesis that intensifies the inflammatory response .

  • Inhibition effects: When ALOX5AP is inhibited with MK-886, there is a decrease in ALOX5/ALOX5AP complex formation, reduced leukotriene production, and attenuated lung injury. This confirms the causal relationship between the complex formation and lung damage .

  • Compartmental distribution: While perinuclear FRET signal is highest, increased levels of ALOX5/ALOX5AP complexes in cytoplasmic and nuclear compartments may result from local membrane and organelle destruction with diffusion of the complex into adjacent compartments during severe injury .

These findings highlight the ALOX5/ALOX5AP complex as a potential therapeutic target for preventing or treating post-traumatic lung injury.

What is known about ALOX5AP genetic polymorphisms and their association with disease risk?

Research on ALOX5AP genetic polymorphisms has focused primarily on their potential association with ischemic stroke (IS) risk. Key findings include:

The current evidence suggests that while certain ALOX5AP polymorphisms have been studied extensively, particularly in relation to stroke risk, a definitive association has not been established. Further research with larger, more diverse cohorts and consideration of gene-environment interactions may be necessary to clarify these relationships.

How can ALOX5AP expression data be integrated with other molecular markers for improved disease classification?

Integration of ALOX5AP expression data with other molecular markers can significantly enhance disease classification, particularly in AML. A comprehensive integration approach should:

  • Combine with established genetic markers: Correlate ALOX5AP expression with known prognostic mutations (e.g., IDH1 mutations) and cytogenetic abnormalities. Research has shown that patients with low ALOX5AP expression more often have IDH1 mutations, suggesting potential molecular interaction networks .

  • Develop multiparameter risk models: Create prognostic models that incorporate ALOX5AP expression with other clinical (age, WBC count) and molecular parameters to improve risk stratification.

  • Analyze pathway interactions: Examine interactions between the leukotriene synthesis pathway and other inflammatory or hematopoietic pathways to identify potential synergistic effects or compensatory mechanisms.

  • Apply machine learning techniques: Use advanced computational methods to identify complex patterns in integrated datasets that may not be apparent through traditional statistical approaches.

  • Validate across multiple cohorts: Confirm the stability and reproducibility of integrated classifications across independent patient populations using datasets like GSE10358, GSE37642, GSE106291, and GSE146173 .

  • Correlate with treatment response: Evaluate whether ALOX5AP-based integrated classifications can predict differential responses to standard therapies or identify patients who might benefit from targeted approaches.

This integrated approach has the potential to enhance personalized medicine strategies by providing more accurate prognostic information and identifying novel therapeutic targets.

What are the current challenges in developing targeted therapeutics against ALOX5AP?

Developing targeted therapeutics against ALOX5AP faces several significant challenges:

  • Specificity of inhibition: Achieving selective inhibition of ALOX5AP without affecting other members of the MAPEG protein family requires highly specific molecular design.

  • Functional redundancy: Other proteins or pathways may compensate for ALOX5AP inhibition, potentially limiting therapeutic efficacy. Understanding these compensatory mechanisms is essential for effective drug development.

  • Tissue-specific effects: ALOX5AP functions differently across various tissues, being notably expressed in lymph nodes, lungs, cerebral cortex, cerebellum, and bone marrow . Therapeutics must account for these tissue-specific roles to minimize off-target effects.

  • Timing of intervention: The optimal timing for ALOX5AP inhibition may differ across disease contexts. For instance, in post-traumatic lung injury, early intervention appears crucial , while in chronic conditions like leukemia, sustained inhibition might be necessary.

  • Complex with ALOX5: Since ALOX5AP functions in complex with ALOX5, understanding the structural basis of this interaction is crucial for designing effective inhibitors. While MK-886 has shown promise in experimental models , optimizing pharmacokinetics and reducing potential toxicity remains challenging.

  • Translational barriers: Moving from preclinical models to clinical applications requires addressing species differences in ALOX5AP structure and function, particularly when working with recombinant rabbit ALOX5AP versus human applications.

  • Genetic variation: Polymorphisms in the ALOX5AP gene may affect response to targeted therapeutics, necessitating personalized approaches .

Addressing these challenges requires integrated research spanning structural biology, pharmacology, genetics, and clinical medicine to develop effective ALOX5AP-targeted therapeutics.

How does the subcellular localization of ALOX5AP affect its function in different disease contexts?

The subcellular localization of ALOX5AP significantly influences its function across different disease contexts through several mechanisms:

  • Nuclear and perinuclear localization: ALOX5AP primarily localizes to the nuclear membrane, where it anchors ALOX5, facilitating leukotriene synthesis. In trauma and hemorrhagic shock models, the highest FRET signal (indicating ALOX5/ALOX5AP interaction) is observed in the perinuclear region . This localization concentrates leukotriene production near the nucleus, potentially affecting nuclear signaling and gene expression.

  • Endoplasmic reticulum (ER) association: ALOX5AP has been reported to localize in the ER , suggesting a role in protein folding quality control or potential involvement in ER stress responses, which may be particularly relevant in conditions like cancer or inflammatory diseases.

  • Compartmental shifts in disease states: During severe injury or cellular stress, disruption of cellular membranes can lead to diffusion of ALOX5/ALOX5AP complexes into adjacent compartments, including cytoplasmic and nuclear domains . These shifts may alter the protein's function and contribute to pathological processes.

  • Differential effects on leukotriene synthesis: The efficiency of leukotriene production appears to depend on proper subcellular localization of ALOX5AP. When ALOX5AP inhibition prevents proper complex formation and localization, leukotriene synthesis is reduced, as observed in lung injury models .

  • Cell-type specific localization patterns: ALOX5AP localization may vary across different cell types relevant to disease, such as leukocytes in inflammation or blast cells in leukemia. These differences could explain tissue-specific effects of ALOX5AP in disease pathogenesis.

Understanding these localization-dependent functions is crucial for developing targeted approaches that disrupt specific ALOX5AP activities while minimizing effects on other cellular processes. Future research should focus on how disease-specific conditions alter ALOX5AP trafficking and localization, potentially identifying novel intervention points.

How should researchers interpret contradictory findings related to ALOX5AP in different experimental models?

When confronted with contradictory findings related to ALOX5AP across different experimental models, researchers should employ a systematic approach to interpretation:

  • Evaluate model differences: Consider fundamental differences between experimental models, including:

    • Species variations (human vs. mouse vs. rabbit)

    • In vitro vs. in vivo systems

    • Acute vs. chronic disease models

    • Cell/tissue types examined

  • Assess methodological variations: Analyze differences in:

    • Detection methods (antibody specificity in FRET, PCR primer design)

    • Quantification approaches (relative vs. absolute)

    • Statistical analyses employed

    • Timing of measurements

  • Consider context-dependent functions: ALOX5AP may have different roles depending on:

    • Disease context (inflammatory conditions vs. cancer)

    • Cell activation state

    • Presence of co-factors or inhibitors

    • Genetic background of the model system

  • Integrate multiple data types: Combine:

    • Expression data

    • Functional assays

    • Genetic studies

    • Clinical correlations

  • Apply meta-analytical thinking: When multiple studies show contradictory results, as seen with ALOX5AP polymorphisms and stroke risk , conduct formal or informal meta-analyses to identify patterns across studies, considering factors such as statistical power, publication bias, and heterogeneity.

  • Design reconciliation experiments: Develop experiments specifically designed to address contradictions by directly comparing models under standardized conditions.

This structured approach helps distinguish genuine biological complexity from technical artifacts and builds a more cohesive understanding of ALOX5AP biology across different experimental contexts.

What statistical approaches are most appropriate for analyzing ALOX5AP expression data in clinical cohorts?

For analyzing ALOX5AP expression data in clinical cohorts, several statistical approaches have proven effective, each addressing specific aspects of data analysis:

  • Grouping strategies:

    • Median-based stratification: Dividing patients into high and low expression groups based on median ALOX5AP expression levels, as used in AML studies

    • Quartile analysis: More granular examination of expression effects by dividing into multiple groups

    • Continuous variable analysis: Treating ALOX5AP expression as a continuous variable in regression models

  • Comparative analyses:

    • Appropriate tests for comparing clinical characteristics between expression groups:

      • t-tests or Mann-Whitney tests for continuous variables

      • Chi-square or Fisher's exact tests for categorical variables

    • Adjustment for multiple comparisons using methods like Bonferroni or False Discovery Rate correction

  • Survival analysis techniques:

    • Kaplan-Meier curves with log-rank tests for visual and statistical comparison of survival outcomes

    • Cox proportional hazards models for multivariable analysis, adjusting for confounding factors like age, WBC counts, and genetic mutations

    • Competing risk analyses when relevant

  • Handling heterogeneity:

    • Random-effects models when significant between-study heterogeneity exists

    • I² statistic to quantify heterogeneity (values of 25%, 50%, and 75% corresponding to low, medium, and high heterogeneity)

    • Stratified analyses by sample characteristics (e.g., ancestry)

  • Genetic association analyses:

    • Allele contrast methods for genetic polymorphism studies

    • Testing for Hardy-Weinberg Equilibrium and conducting sensitivity analyses excluding studies with HWE deviation

    • Assessment of publication bias using funnel plots, Begg's and Egger's tests

  • Integrated multi-omics approaches:

    • Correlation analyses between expression and methylation data

    • Pathway enrichment analyses to identify related biological processes

    • Network analyses to understand interactions with other molecules

These statistical approaches, when appropriately applied and reported, enhance the robustness and clinical relevance of ALOX5AP expression analyses in patient cohorts.

How can researchers effectively validate novel findings related to ALOX5AP function?

Effective validation of novel findings related to ALOX5AP function requires a comprehensive, multi-level approach:

  • Technical validation:

    • Repeat experiments using alternative detection methods (e.g., different antibodies, PCR primers)

    • Confirm findings using multiple experimental replicates

    • Implement appropriate controls (positive, negative, isotype)

    • Use complementary techniques (e.g., validate protein findings with RNA data)

  • Biological validation:

    • Test findings across multiple cell lines or primary cell types

    • Validate in different animal models when applicable

    • Use both gain-of-function and loss-of-function approaches:

      • Genetic knockdown/knockout (siRNA, CRISPR)

      • Pharmacological inhibition (e.g., MK-886 for ALOX5AP)

      • Overexpression systems

  • Clinical validation:

    • Confirm findings in independent patient cohorts

    • Use multiple independent datasets (e.g., GSE10358, GSE37642, GSE106291, GSE146173)

    • Stratify analyses by relevant clinical variables

    • Correlate molecular findings with clinical outcomes

  • Mechanistic validation:

    • Demonstrate direct molecular interactions (e.g., FRET for ALOX5/ALOX5AP interaction)

    • Establish causality through intervention studies

    • Map complete pathway relationships

    • Identify potential confounding factors or compensatory mechanisms

  • Computational validation:

    • Apply in silico modeling approaches

    • Use public databases to test consistency with existing knowledge

    • Employ machine learning for pattern recognition across datasets

  • Independent laboratory validation:

    • Collaborate with external groups to independently reproduce key findings

    • Share detailed protocols, reagents, and analysis methods

This multi-faceted validation approach strengthens the reliability and broader applicability of novel findings related to ALOX5AP function, facilitating translation from basic discovery to clinical application.

What emerging technologies might enhance our understanding of ALOX5AP biology?

Several cutting-edge technologies show particular promise for advancing ALOX5AP research:

  • Advanced imaging techniques:

    • Super-resolution microscopy beyond traditional FRET to visualize ALOX5AP-ALOX5 interactions at nanometer scales

    • Live-cell imaging to track dynamic changes in ALOX5AP localization and interactions in real-time

    • Correlative light and electron microscopy (CLEM) to connect molecular interactions with ultrastructural context

  • Single-cell technologies:

    • Single-cell RNA sequencing to reveal cell-specific expression patterns and heterogeneity

    • Single-cell proteomics to characterize ALOX5AP protein levels and modifications at individual cell resolution

    • Spatial transcriptomics to map ALOX5AP expression within tissue microenvironments

  • CRISPR-based approaches:

    • CRISPR screening to identify synthetic lethal interactions with ALOX5AP

    • Base editing or prime editing for precise modification of ALOX5AP or regulatory elements

    • CRISPR activation/inhibition systems for temporal control of ALOX5AP expression

  • Structural biology innovations:

    • Cryo-electron microscopy to determine high-resolution structures of ALOX5AP-ALOX5 complexes

    • Hydrogen-deuterium exchange mass spectrometry to map protein interaction surfaces

    • Computational modeling of dynamic protein interactions and conformational changes

  • Multi-omics integration:

    • Combined analysis of genomics, transcriptomics, proteomics, and metabolomics data

    • Network biology approaches to position ALOX5AP within cellular signaling pathways

    • Systems biology modeling of leukotriene synthesis and inflammatory cascades

  • Organoid and microphysiological systems:

    • Patient-derived organoids to study ALOX5AP in disease-relevant microenvironments

    • Organ-on-chip technologies to model complex tissue interactions

    • 3D bioprinting to create precise arrangements of cells expressing ALOX5AP

These emerging technologies promise to provide unprecedented insights into ALOX5AP biology, potentially revealing new therapeutic opportunities and biomarker applications across various disease contexts.

How might ALOX5AP research contribute to precision medicine approaches in inflammatory diseases?

ALOX5AP research has significant potential to advance precision medicine in inflammatory diseases through several avenues:

  • Patient stratification biomarkers:

    • ALOX5AP expression patterns could identify patient subgroups most likely to benefit from targeted anti-inflammatory therapies

    • Similar to findings in AML where ALOX5AP expression correlates with clinical outcomes , inflammatory disease patients might be stratified based on ALOX5AP profiles

  • Genetic profiling for treatment selection:

    • Screening for ALOX5AP polymorphisms could guide therapy choices

    • Although meta-analyses have not shown consistent associations with stroke risk , specific polymorphisms might predict treatment response in inflammatory conditions

  • Targeted therapeutic development:

    • Novel ALOX5AP inhibitors with improved specificity over compounds like MK-886

    • Structure-based drug design targeting specific ALOX5AP-ALOX5 interaction surfaces

    • Tissue-specific delivery systems to target ALOX5AP in affected tissues while sparing normal function elsewhere

  • Combination therapy optimization:

    • Identifying synergistic combinations of ALOX5AP inhibitors with other anti-inflammatory agents

    • Sequential treatment protocols based on temporal dynamics of ALOX5AP activity

    • Personalized dosing regimens based on individual ALOX5AP expression levels

  • Dynamic biomarkers for treatment monitoring:

    • Serial assessment of ALOX5AP activity or leukotriene production as pharmacodynamic markers

    • Integration with clinical parameters to create composite response indicators

    • Non-invasive methods to monitor ALOX5AP-related inflammation

  • Prevention strategies in high-risk individuals:

    • Early intervention in patients with ALOX5AP expression patterns associated with disease progression

    • Prophylactic approaches in trauma scenarios to prevent complications like lung injury

    • Lifestyle or dietary interventions that modulate ALOX5AP activity in susceptible individuals

These precision medicine applications could significantly improve outcomes across various inflammatory conditions, from acute scenarios like post-traumatic lung injury to chronic inflammatory diseases, by matching specific interventions to individual patient characteristics based on ALOX5AP biology.

What interdisciplinary approaches might accelerate translation of ALOX5AP findings to clinical applications?

Accelerating the translation of ALOX5AP research to clinical applications requires strategic interdisciplinary collaboration:

  • Integrating basic science with clinical research:

    • Establish consortia connecting laboratory scientists studying ALOX5AP mechanisms with clinical researchers

    • Design research with clinical endpoints in mind from early stages

    • Develop parallel animal and human studies to facilitate rapid translation

  • Bioengineering and pharmaceutical partnerships:

    • Collaborate with drug delivery experts to optimize targeting of ALOX5AP inhibitors

    • Work with medicinal chemists to develop highly specific modulators of ALOX5AP function

    • Engage bioengineers to create improved assay systems for ALOX5AP activity

  • Computational and data science integration:

    • Utilize machine learning to identify patterns in ALOX5AP data that predict disease outcomes

    • Apply network medicine approaches to position ALOX5AP within disease-relevant pathways

    • Develop predictive models that incorporate ALOX5AP data to guide clinical decision-making

  • Regulatory science collaboration:

    • Work with regulatory experts early in development to design appropriate validation studies

    • Develop biomarker qualification strategies for ALOX5AP-based diagnostics

    • Create streamlined paths for companion diagnostics development alongside therapeutics

  • Patient engagement and participatory research:

    • Include patient perspectives in research design, particularly for clinical trials

    • Develop patient-reported outcomes relevant to ALOX5AP-mediated diseases

    • Create bidirectional communication channels between researchers and patient communities

  • Implementation science approaches:

    • Study barriers to adoption of ALOX5AP-based diagnostics or therapeutics

    • Develop strategies to integrate new approaches into existing clinical workflows

    • Create educational resources for healthcare providers about ALOX5AP biology

  • Economic and health policy research:

    • Assess cost-effectiveness of ALOX5AP-targeted approaches

    • Study healthcare system factors that influence adoption of precision medicine strategies

    • Engage with policymakers to address reimbursement considerations

By fostering these interdisciplinary connections, the scientific community can create an ecosystem that accelerates translation of ALOX5AP findings from bench to bedside, ultimately improving patient outcomes across multiple disease contexts.

What standardized protocols should researchers adopt when working with recombinant rabbit ALOX5AP?

Based on the available research, the following standardized protocols are recommended when working with recombinant rabbit ALOX5AP:

  • Protein expression and purification:

    • Use bacterial expression systems (E. coli) with appropriate fusion tags for solubility

    • Implement multi-step purification including affinity chromatography and size exclusion

    • Verify protein identity by mass spectrometry and Western blotting

    • Assess protein quality through circular dichroism or thermal shift assays

  • Activity assays:

    • Measure functional activity through ALOX5 activation assays using purified components

    • Quantify leukotriene production via LC-MS/MS or ELISA methods

    • Include appropriate positive controls (human ALOX5AP) and negative controls

  • Interaction studies:

    • For in vitro studies, use surface plasmon resonance or isothermal titration calorimetry to quantify binding to ALOX5

    • For cellular studies, implement FRET microscopy with appropriate controls for bleed-through as detailed in published protocols

    • When assessing inhibitor effects, include dose-response curves and time-course analyses

  • Cellular localization:

    • Use subcellular fractionation followed by Western blotting

    • Apply confocal microscopy with nuclear and ER markers

    • Partition cellular structures into cytosolic, perinuclear, and nuclear domains using established masking functions

  • Data reporting standards:

    • Report protein concentrations, buffer compositions, and reaction conditions in detail

    • Include raw data alongside normalized results

    • Provide detailed methods for statistical analysis including sample sizes and power calculations

    • Clearly distinguish between technical and biological replicates

  • Validation approaches:

    • Confirm key findings using multiple antibodies or detection methods

    • Validate across multiple experimental models

    • Include comparison to human ALOX5AP to assess species-specific differences

Adoption of these standardized protocols will enhance reproducibility and facilitate comparison across studies, accelerating progress in understanding ALOX5AP biology and its therapeutic applications.

What are the key considerations for researchers designing animal studies involving ALOX5AP?

Researchers designing animal studies involving ALOX5AP should consider the following key factors:

  • Species selection and considerations:

    • Recognize species differences in ALOX5AP sequence, structure, and function

    • Consider using transgenic models expressing human ALOX5AP for translational studies

    • Select species appropriate to the disease model (e.g., rodents for AML models, larger animals for trauma studies)

  • Study design elements:

    • Implement appropriate randomization and blinding procedures

    • Include adequate sample sizes based on power calculations

    • Design studies with both sexes to identify potential sex-based differences

    • Consider age effects, particularly in models where ALOX5AP expression changes with age

  • Disease model selection:

    • For post-traumatic lung injury, established trauma and hemorrhagic shock (T/HS) models have demonstrated ALOX5AP involvement

    • For hematological disorders, consider bone marrow transplantation models

    • For inflammatory conditions, use established models with validated endpoints

  • Intervention approaches:

    • When testing ALOX5AP inhibitors like MK-886, establish dose-response relationships

    • Consider timing of intervention (prophylactic vs. therapeutic)

    • Evaluate both short-term effects and long-term outcomes

  • Comprehensive endpoint assessment:

    • Molecular endpoints: ALOX5/ALOX5AP complex formation, leukotriene production

    • Tissue-specific endpoints: histopathological analysis, tissue function tests

    • Systemic endpoints: inflammatory markers, survival outcomes

    • Include both acute and chronic timepoints when relevant

  • Ethical considerations:

    • Implement the 3Rs principle (Replacement, Reduction, Refinement)

    • Establish humane endpoints specific to the disease model

    • Obtain appropriate ethical approvals and follow institutional guidelines

  • Translational focus:

    • Design experiments with clear translational pathways to human applications

    • Include clinically relevant biomarkers and outcomes

    • Consider pharmacokinetic/pharmacodynamic relationships that will inform human dosing

These considerations will help researchers design rigorous, ethically sound animal studies that maximize translational potential while addressing key questions about ALOX5AP biology and therapeutic targeting.

How should researchers approach conflicting data on ALOX5AP expression and function across different tissue types?

When facing conflicting data on ALOX5AP expression and function across different tissue types, researchers should adopt a systematic approach:

  • Tissue-specific context analysis:

    • Recognize that ALOX5AP is known to be differently expressed across tissues, with notable expression in lymph nodes, lungs, cerebral cortex, cerebellum, and bone marrow

    • Evaluate cellular composition of each tissue, as ALOX5AP expression varies across cell types

    • Consider tissue microenvironment factors that might influence ALOX5AP function

  • Methodological standardization:

    • Apply consistent methods across tissue types when possible

    • When different methods are necessary, validate with overlapping approaches

    • Account for tissue-specific technical challenges (e.g., lipid-rich vs. lipid-poor tissues)

  • Developmental and physiological considerations:

    • Assess whether differences reflect developmental stages, as seen in hematopoietic cells where ALOX5AP expression changes during differentiation

    • Consider physiological state (resting vs. activated) of tissues during sample collection

    • Account for circadian or other temporal variations

  • Comparative experimental design:

    • Design experiments that directly compare tissues under identical conditions

    • Process and analyze samples from different tissues in parallel

    • Include tissue-specific positive controls to validate assay performance

  • Integrated multi-omics approach:

    • Correlate expression data with functional outcomes in each tissue

    • Analyze epigenetic regulation that might explain tissue-specific expression patterns

    • Examine protein-protein interactions that might differ across tissues

  • Comprehensive literature analysis:

    • Perform systematic reviews of tissue-specific findings

    • Apply meta-analytical approaches where appropriate

    • Identify patterns in conflicting data that might suggest biological principles

  • Collaborative validation:

    • Establish multi-laboratory collaborations to confirm key findings across different tissues

    • Create tissue-specific working groups to develop consensus protocols

    • Share resources (antibodies, recombinant proteins, cell lines) to minimize technical variability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.