Recombinant Rabbit ATP-sensitive inward rectifier potassium channel 11 (KCNJ11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNJ11; KIR62; ATP-sensitive inward rectifier potassium channel 11; Inward rectifier K(+ channel Kir6.2; Potassium channel, inwardly rectifying subfamily J member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
KCNJ11
Target Protein Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWTHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGAAVPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVIALRQGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNSIFLVAPLIIHHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALT LTSARGPLRKRSVPVAKAKPKFSISPDSLS
Uniprot No.

Target Background

Function
This G protein-regulated receptor belongs to the inward rectifier potassium channel family. These channels exhibit a preference for potassium influx over efflux. Their voltage dependence is modulated by extracellular potassium concentration; increasing extracellular potassium shifts the voltage range of channel opening towards more positive potentials. Inward rectification primarily results from intracellular magnesium block of outward current. Extracellular barium can block the channel. KCNJ11 can form cardiac and smooth muscle-type KATP channels in conjunction with ABCC9. KCNJ11 constitutes the channel pore, while ABCC9 is essential for activation and regulation.
Gene References Into Functions
  1. While Kir6.2 channel subtype expression remains consistent between aortic smooth muscle cells in control and hypertrophied models, Kir6.1 and SUR2B subtype expression is reduced in left ventricular hypertrophy models. PMID: 22572849
Database Links

KEGG: ocu:100008648

UniGene: Ocu.2130

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ11 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is KCNJ11 and what is its fundamental role in cellular physiology?

KCNJ11 is an ATP-sensitive inward rectifier potassium channel expressed in various tissues including endocrine cells, neurons, and both smooth and striated muscle. It forms the pore-forming subunit of ATP-sensitive potassium (KATP) channels. These channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it, with voltage dependence regulated by extracellular potassium concentration . As external potassium increases, the voltage range of channel opening shifts to more positive voltages.

KCNJ11 plays crucial roles in:

  • Controlling insulin secretion from pancreatic β-cells

  • Regulating vascular tone in smooth muscle

  • Protecting neurons under metabolic stress conditions

  • Maintaining glucose homeostasis

KATP channels act as metabolic sensors, linking cellular energy status to membrane excitability by closing in response to increased ATP levels, which is a key mechanism in glucose-stimulated insulin secretion.

What experimental techniques are most effective for studying KCNJ11 expression and localization?

Several complementary techniques are recommended for comprehensive analysis of KCNJ11 expression and localization in research settings:

  • Immunohistochemistry (IHC): Effective for tissue localization with recommended antibody dilutions of 1:50-1:200. Protocols should include heat-mediated antigen retrieval in citrate buffer for optimal results .

  • Immunofluorescence (IF): Provides cellular and subcellular localization with recommended dilutions of 1:100-1:500. Sample preparation should include PFA fixation and 0.1% Triton X-100 permeabilization .

  • Western Blot (WB): For quantitative protein expression analysis with recommended antibody dilutions of 1:500-1:2000 .

  • Immunocytochemistry (ICC): For detailed subcellular localization studies in cultured cells.

  • RT-PCR and qPCR: For mRNA expression analysis and quantification.

Each technique requires specific optimization for KCNJ11 detection, especially regarding fixation methods, antigen retrieval, and antibody selection based on species reactivity and epitope recognition.

How do KCNJ11 mutations affect neurological and cognitive development?

KCNJ11 mutations are associated with significant neurological and cognitive impairments that persist into adulthood, even with appropriate sulfonylurea therapy. Recent studies have characterized these effects extensively:

  • Neurological examination findings:

    • 7/8 individuals with KCNJ11 mutations exhibited abnormal neurological examinations

    • Predominant features included subtle deficits in coordination and motor sequencing

  • Developmental impacts:

    • All studied individuals had delayed developmental milestones

    • Required learning support and/or special education accommodations

  • Cognitive profile:

    • Impaired attention and working memory

    • Reduced perceptual reasoning abilities

    • Significantly reduced IQ (median IQ in KCNJ11 mutation carriers: 76, compared to 111 in INS mutation carriers, p=0.02)

  • Neurodevelopmental disorders:

    • 50% of individuals with KCNJ11 mutations exhibited features consistent with autism spectrum disorder

Importantly, these neurological features:

  • Are not due to long-standing diabetes

  • Persist into adulthood despite sulfonylurea therapy

  • Represent the major disease burden for individuals with KCNJ11 mutations

Methodologically, researchers should employ comprehensive neuropsychological test batteries and consider comparing KCNJ11 mutation carriers to individuals with INS mutations to control for general diabetes-related cognitive effects.

What methodological approaches should be used to study the relationship between KCNJ11 polymorphisms and metabolic disorders?

Research on KCNJ11 polymorphisms requires robust methodological approaches:

  • Study design considerations:

    • Case-control studies with careful matching for age, sex, BMI, and ethnicity

    • Prospective cohort studies following pre-diabetic populations

    • Meta-analyses integrating multiple studies using standardized quality assessment tools like Newcastle-Ottawa Scale (NOS)

  • Genotyping approaches:

    • Focus on key polymorphisms such as E23K (rs5219) and rs2285676 which have established associations with metabolic disorders

    • Use appropriate statistical models (dominant, recessive, allelic) based on prior evidence

  • Statistical analysis methods:

    • Calculate odds ratios (ORs) with 95% confidence intervals

    • Assess heterogeneity using I² and Q statistics

    • Apply fixed-effect (Mantel-Haenszel) or random-effect (DerSimonian and Laird) models based on heterogeneity assessment

    • Perform sensitivity analyses to test result stability by sequentially excluding individual studies

  • Addressing publication bias:

    • Apply Begg and Egger tests

    • Use funnel plots to visualize potential publication bias

A recent meta-analysis demonstrated significant associations between the dominant model of KCNJ11 E23K and essential hypertension risk (P = .006, OR [95%CI] = 0.45 [0.25, 0.79]) . This methodological framework provides a template for researchers investigating other KCNJ11 polymorphisms and their associations with metabolic conditions.

How can researchers differentiate between KCNJ11 mutation-specific CNS features and diabetes-related cognitive impairments?

Differentiating KCNJ11 mutation-specific central nervous system (CNS) features from general diabetes-related cognitive impairments requires careful methodological design:

  • Control group selection:

    • Compare individuals with KCNJ11 mutations to those with INS mutations, as both cause neonatal diabetes but only KCNJ11 is expressed in brain KATP channels

    • This controls for non-specific diabetes-related cognitive features that could confound assessment

  • Comprehensive assessment protocol:

    • Standardized neurological examination

    • Detailed neuropsychological assessment including:

      • Intelligence testing

      • Attention and working memory tasks

      • Executive function assessment

      • Motor coordination evaluation

    • Structured neurodevelopmental screening

    • Brain imaging (MRI) to assess structural abnormalities

  • Statistical approach:

    • Non-parametric methods for comparing characteristics between groups (Mann-Whitney test for numerical variables; Fisher's exact test for categorical variables)

    • Convert neuropsychological test scores to Z-scores where population normative data is available

    • Present data as median (range)

Research implementing this methodology has demonstrated that KCNJ11 PNDM is associated with specific CNS features that:

  • Are not attributable to long-standing diabetes

  • Persist despite adequate glycemic control with sulfonylurea therapy

  • Represent a pattern distinct from typical diabetes-related cognitive impairment

What is the optimal experimental design for studying KCNJ11's role in essential hypertension?

When investigating KCNJ11's role in essential hypertension (EH), researchers should implement a multi-tiered experimental design:

  • Human genetic association studies:

    • Focus on polymorphisms with established clinical relevance such as E23K (rs5219) and E65K

    • Account for population-specific effects (especially Asian vs. Caucasian differences)

    • Implement proper inclusion/exclusion criteria to define EH cases and controls

    • Conduct power calculations to ensure adequate sample size

  • Meta-analysis approach:

    • Follow PRISMA guidelines for systematic review

    • Apply quality assessment tools (e.g., Newcastle-Ottawa Scale)

    • Test associations using different genetic models (allelic, dominant, recessive)

    • Assess heterogeneity (I² value >50% indicates significant heterogeneity)

  • Functional studies:

    • Employ patch-clamp electrophysiology to assess channel function

    • Develop animal models (e.g., knock-in mice with specific KCNJ11 variants)

    • Apply tissue-specific gene expression analysis in vascular smooth muscle

Recent meta-analysis has shown that the dominant models of KCNJ11 E23K are significantly associated with EH risk in Asian populations (P = .006, OR [95%CI] = 0.45 [0.25, 0.79]) . This finding provides direction for future functional studies investigating the molecular mechanisms underlying this association.

How does KCNJ11 interact with regulatory proteins to form functional KATP channels?

KCNJ11 (Kir6.2) forms functional ATP-sensitive potassium (KATP) channels through specific protein-protein interactions:

  • Core complex formation:

    • KCNJ11 forms the channel pore through tetrameric assembly

    • Each functional KATP channel contains four KCNJ11 subunits associated with four regulatory sulfonylurea receptor (SUR) subunits

    • KCNJ11 primarily interacts with either ABCC8 (SUR1) or ABCC9 (SUR2)

  • Functional roles within the complex:

    • KCNJ11 forms the central ion-conducting pore

    • ABCC8/ABCC9 is required for channel activation and regulation

    • This heteromeric assembly confers specific pharmacological properties and metabolic sensing capabilities

  • Subunit-specific interactions:

    • KCNJ11 can form cardiac and smooth muscle-type KATP channels when coupled with ABCC9/SUR2

    • Pancreatic β-cell KATP channels predominantly consist of KCNJ11 with ABCC8/SUR1

  • Post-translational regulation:

    • Phosphorylation by MAPK1 modifies channel gating, destabilizing closed states and reducing ATP sensitivity

    • This provides an additional regulatory mechanism beyond direct nucleotide sensing

These protein interactions are critical for proper channel function and represent potential targets for therapeutic intervention in KCNJ11-related pathologies.

What experimental systems are most effective for studying KCNJ11 regulation by ATP and pharmacological agents?

Several experimental systems provide complementary insights into KCNJ11 regulation:

  • Heterologous expression systems:

    • HEK293 or COS-7 cells transfected with KCNJ11 alone or co-expressed with SUR subunits

    • Xenopus oocytes for electrophysiological studies

    • Advantages include controlled expression and easy genetic manipulation

  • Patch-clamp electrophysiology:

    • Inside-out patch configuration allows direct application of ATP to cytoplasmic channel face

    • Whole-cell recordings for studying integrated cellular responses

    • Measurements should include:

      • Channel open probability

      • Single-channel conductance

      • ATP dose-response relationships

      • Pharmacological agent effects

  • Fluorescence-based assays:

    • Membrane potential-sensitive dyes for high-throughput screening

    • FRET sensors to measure ATP-KCNJ11 interactions

  • Native tissue preparations:

    • Isolated pancreatic islets for studying insulin secretion

    • Cardiac myocytes for examining cardiac KATP function

    • Brain slices for neuronal KATP channel activity

  • Animal models:

    • Transgenic mice expressing KCNJ11 mutations

    • Physiological studies relating channel function to whole-organism phenotypes

When designing experiments, researchers should consider that KCNJ11 forms the channel pore while SUR subunits confer regulation and pharmacological sensitivity . This bipartite nature necessitates careful consideration of both components when studying channel regulation.

How do KCNJ11 mutations contribute to different forms of neonatal diabetes and hyperinsulinism?

KCNJ11 mutations cause distinct clinical phenotypes through specific mechanisms:

  • Neonatal diabetes mechanisms:

    • Gain-of-function mutations increase KATP channel activity

    • Enhanced potassium efflux hyperpolarizes β-cell membrane

    • Prevents voltage-gated calcium channel activation required for insulin secretion

    • Results in permanent neonatal diabetes mellitus (PNDM) or transient neonatal diabetes mellitus type 3 (TNDM3)

  • Hyperinsulinism mechanisms:

    • Loss-of-function mutations decrease KATP channel activity

    • Leads to constitutive β-cell membrane depolarization

    • Causes persistent calcium influx and insulin secretion

    • Results in familial persistent hyperinsulinemic hypoglycemia of infancy (PHHI)

  • Mutation-specific effects:

    • Severity depends on specific mutation and its effect on channel function

    • Some mutations (e.g., V59M) are associated with more severe neurological phenotypes than others

    • Novel dominant mutation in KCNJ11 can cause late-onset PHHI through defective surface expression of Kir6.2

  • Beyond pancreatic effects:

    • CNS expression of KCNJ11 explains why mutations lead to neurological phenotypes

    • 7/8 individuals with KCNJ11 mutations show neurological abnormalities despite sulfonylurea therapy

    • Developmental delays and autism spectrum features occur in approximately 50% of cases

Understanding these mechanisms is crucial for developing targeted therapies and predicting clinical outcomes based on specific mutations.

What methodological approaches should be used to study sulfonylurea responsiveness in different KCNJ11 mutations?

Comprehensive evaluation of sulfonylurea responsiveness in KCNJ11 mutations requires a multi-faceted approach:

  • In vitro functional studies:

    • Heterologous expression of mutant KCNJ11 in cell lines

    • Patch-clamp electrophysiology to measure channel activity

    • Dose-response curves for different sulfonylureas

    • Measures of channel trafficking and membrane expression

  • Clinical response assessment:

    • Standardized protocols for sulfonylurea transition (from insulin)

    • Regular monitoring of glycemic control (HbA1c, glucose variability)

    • Long-term follow-up to assess sustained efficacy

    • Evaluation of non-glycemic outcomes (neurological, developmental)

  • Genotype-phenotype correlation studies:

    • Compare sulfonylurea responsiveness across different mutations

    • Analyze structure-function relationships to predict drug sensitivity

    • Consider effects of genetic modifiers and patient factors

  • CNS-specific considerations:

    • Assess whether sulfonylureas adequately address neurological features

    • Compare outcomes in different domains (metabolic vs. neurological)

    • Studies indicate neurological features persist despite sulfonylurea therapy, suggesting this remains the major disease burden

  • Novel therapeutic exploration:

    • Screen compound libraries for mutation-specific KATP channel modulators

    • Develop strategies targeting channel trafficking for mutations affecting surface expression

    • Investigate CNS-penetrant sulfonylureas or alternative approaches for neurological manifestations

This comprehensive approach allows researchers to develop personalized treatment strategies based on specific mutations and their functional consequences.

What are the key considerations when developing animal models for studying KCNJ11 mutations?

Developing effective animal models for KCNJ11 research requires careful consideration of several key factors:

  • Model selection criteria:

    • Species-specific differences in KCNJ11 expression and function

    • Feasibility of genetic manipulation (knockout, knock-in)

    • Relevance to human physiology and disease

    • Availability of tissue-specific expression systems

  • Mutation introduction strategies:

    • CRISPR/Cas9 gene editing for precise mutation introduction

    • Conditional expression systems to control timing and tissue specificity

    • Humanized models expressing human KCNJ11 variants

  • Phenotypic characterization:

    • Metabolic assessment (glucose tolerance, insulin secretion)

    • Neurological evaluation (cognitive tests, motor function)

    • Electrophysiological studies (patch-clamp of isolated cells)

    • Histological examination of relevant tissues

  • Experimental design considerations:

    • Include appropriate controls (wild-type, heterozygous, homozygous)

    • Account for sex-specific differences

    • Implement blinded assessment of outcomes

    • Longitudinal studies to capture developmental or progressive phenotypes

  • Translational relevance:

    • Correlation with human patient data

    • Drug response testing (sulfonylureas, novel compounds)

    • Assessment of both pancreatic and extra-pancreatic manifestations

When evaluating neurological phenotypes, researchers should note that human studies have demonstrated specific cognitive and neurological features in KCNJ11 mutation carriers that represent a significant disease burden . Animal models should aim to recapitulate these features to facilitate development of targeted therapies.

What are the most promising areas for future KCNJ11 research?

Several high-priority research directions emerge from current understanding of KCNJ11:

  • CNS-targeted therapeutic approaches:

    • Development of brain-penetrant KATP channel modulators

    • Investigation of timing-dependent interventions for neurodevelopmental features

    • Exploration of combination therapies addressing both metabolic and neurological manifestations

    • Studies indicate neurological features persist despite sulfonylurea therapy, highlighting this unmet medical need

  • Population-specific genetic associations:

    • Expanded investigation of KCNJ11 polymorphisms in diverse ethnic groups

    • Focus on variants like E23K (rs5219) that show population-specific associations with conditions such as essential hypertension in Asian populations

    • Integration of whole-genome data to identify genetic modifiers

  • Structure-function relationships:

    • Cryo-EM studies of complete KATP channel complexes with various mutations

    • Investigation of conformational dynamics during gating

    • Computational modeling to predict mutation effects and drug responses

  • Novel biomarkers for personalized medicine:

    • Identification of predictive markers for sulfonylurea responsiveness

    • Development of screening approaches for neurological risk in KCNJ11 mutation carriers

    • Longitudinal studies correlating genotype with long-term outcomes

  • Gene therapy approaches:

    • Development of targeted gene editing strategies for specific mutations

    • Investigation of tissue-specific delivery methods

    • Assessment of efficacy in reversing established phenotypes

These research directions address critical knowledge gaps and could lead to improved therapeutic approaches for individuals with KCNJ11-related disorders.

What methodological innovations could advance our understanding of KCNJ11 biology?

Emerging technologies and methodological innovations hold promise for advancing KCNJ11 research:

  • Single-cell analysis techniques:

    • Single-cell RNA sequencing to identify cell-specific expression patterns

    • Patch-seq combining electrophysiology with transcriptomics

    • Spatial transcriptomics to map KCNJ11 expression in complex tissues

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize channel distribution and trafficking

    • Live-cell imaging with fluorescent sensors for ATP and membrane potential

    • Correlative light and electron microscopy for structural-functional integration

  • Organoid and iPSC models:

    • Patient-derived induced pluripotent stem cells (iPSCs) differentiated into relevant cell types

    • Pancreatic and brain organoids to study tissue-specific effects

    • Co-culture systems to investigate cell-cell interactions

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics)

    • Network analysis to identify KCNJ11-associated pathways

    • Mathematical modeling of KATP channel dynamics in cellular physiology

  • Longitudinal clinical studies:

    • Comprehensive phenotyping of individuals with KCNJ11 mutations across life stages

    • Integration of glycemic measures with neuropsychological assessment

    • Development of standardized assessment batteries specific for KCNJ11-related disorders

Implementation of these methodological innovations could reveal new insights into how KCNJ11 mutations affect neurodevelopment and metabolism, potentially leading to novel therapeutic strategies addressing both pancreatic and extra-pancreatic manifestations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.