Recombinant Rabbit ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Rabbit MT-ATP6 refers to the rabbit-derived mitochondrial ATP synthase subunit a produced via heterologous expression systems. The native MT-ATP6 gene encodes a transmembrane protein integral to ATP synthase (Complex V), which catalyzes the final step of oxidative phosphorylation by converting ADP to ATP using a proton gradient .

Key functions:

  • Forms part of the F₀ domain of ATP synthase, facilitating proton translocation across the mitochondrial inner membrane .

  • Enables coupling of proton flow to ATP synthesis via rotational catalysis .

Production and Purification

Expression systems:

  • Escherichia coli: Widely used for high-yield production of recombinant MT-ATP6 with N-terminal His tags .

  • Yeast models: Employed to study pathogenicity of human MT-ATP6 mutations .

Yield and Purity:

  • Typical yields: 0.5–2 mg/L culture .

  • Purity: >90% by SDS-PAGE .

Research Applications

Key studies:

  • Disease modeling: Recombinant MT-ATP6 aids in studying mitochondrial disorders like Leigh syndrome and NARP .

  • Antibody development: Rabbit monoclonal antibodies (e.g., A23150) target MT-ATP6 for Western blotting (1:1000–1:5000 dilution) .

  • Functional analysis: Yeast complementation assays reveal ATP synthase assembly defects in pathogenic variants (e.g., p.H168R) .

Notable findings:

VariantBiochemical DefectClinical Association
m.8993T>G↑ Mitochondrial membrane potentialNARP syndrome
m.9185T>C↓ ATP hydrolysis, impaired F₀ assemblyLeigh syndrome
p.N163SDisrupted proton channel stabilityRespiratory defects

Challenges and Future Directions

Current limitations:

  • Heterologous expression often lacks post-translational modifications present in native mitochondria .

  • Structural studies are hindered by the protein’s hydrophobicity .

Emerging approaches:

  • Cryo-EM to resolve full-length ATP synthase complexes .

  • Gene-editing models (e.g., CRISPR/Cas9) to study tissue-specific MT-ATP6 mutations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize the development of the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MNENLFSSFATPTLMGLPIVALIIMFPTLLFPSPSRLINNRLVSTQQWLAQLILKQMMLM HSPKGRTWSLMLISLIMFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRYK TKASLAHFLPQGTPIPLIPMLIVIETISLFIQPMALAVRLTANITAGHLLMHLIGGAALA LVSISPTTALITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) catalyzes ATP production from ADP in the presence of a proton gradient across the membrane, which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, connected via a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. This protein is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in ATP synthase?

MT-ATP6 is a mitochondrially encoded gene that provides information for making a protein essential for normal mitochondrial function. This protein forms one subunit of the large enzyme complex known as ATP synthase (Complex V). ATP synthase is responsible for the final step of oxidative phosphorylation, catalyzing ATP synthesis by utilizing an electrochemical gradient of protons across the inner mitochondrial membrane .

The ATP synthase complex consists of two main structural domains: F1, which contains the extramembraneous catalytic core, and F0, which contains the membrane proton channel. These domains are linked together by central and peripheral stalks . The MT-ATP6 protein specifically forms part of the F0 domain, which allows positively charged protons to flow across the specialized inner mitochondrial membrane. This proton flow creates energy that the F1 domain uses to convert adenosine diphosphate (ADP) to adenosine triphosphate (ATP) .

How does ATP synthase structure relate to its function?

ATP synthase operates through a rotary mechanism where ATP synthesis in the catalytic domain of F1 is coupled to proton translocation through the F0 domain. The enzyme consists of multiple subunits organized in a specific architecture:

DomainMajor SubunitsStructureFunction
F1 (Catalytic Core)α, β, γ, δ, εSoluble, extends into matrixATP synthesis, arranged as 3α and 3β with single copies of others
F0 (Membrane Domain)a, b, c, d, e, f, g, F6, and 8Membrane-embeddedProton channel, includes c-ring structure
Central Stalkγ, δ, εConnects F1 to F0Transmits rotational energy
Peripheral Stalkb, d, F6, OSCPSide connectionPrevents rotation of F1 relative to F0

The proton channel component includes subunit c, which forms a homomeric c-ring structure that is part of the complex rotary element, consisting of approximately 10 subunits . During ATP synthesis, the flow of protons through the F0 domain drives rotation of the c-ring and central stalk, causing conformational changes in the β subunits of F1 that enable ATP synthesis.

What experimental approaches are used to study MT-ATP6 function?

Researchers employ various techniques to investigate MT-ATP6 function:

  • Biochemical Assays: Measurement of ATP synthesis rate and ATP hydrolysis capacity. Studies have shown that pathogenic MT-ATP6 variants typically result in reduced ATP synthesis while ATP hydrolysis capacity may be preserved .

  • Membrane Potential Analysis: Assessment of mitochondrial membrane potential using fluorescent probes. Abnormally increased mitochondrial membrane potential is frequently observed in cells with MT-ATP6 mutations .

  • Recombinant Protein Expression: Production of recombinant ATP synthase components for structural and functional studies. Commercial antibodies like ATP synthase C antibodies can be used to detect these proteins in experimental systems .

  • Mutational Analysis: Introduction of specific mutations to study their impact on ATP synthase function. This approach has helped characterize pathogenic variants like m.8993T>G and m.8993T>C .

  • Heteroplasmy Quantification: Techniques to measure the proportion of mutated mtDNA in tissues or cells. This is critical as heteroplasmy levels can influence disease manifestation .

How do mutations in MT-ATP6 affect ATP synthase function and cause disease?

Mutations in MT-ATP6 lead to diverse biochemical abnormalities and clinical manifestations. In a comprehensive review of 218 reported MT-ATP6 disease cases plus 14 new kindreds, researchers found significant correlation between heteroplasmy levels and symptom presence, although with extensive overlap between symptomatic and asymptomatic carriers .

The most common pathogenic mutations include:

MutationFrequencyCommon Clinical Presentations
m.8993T>G40% (53/132)Leigh syndrome, high severity
m.8993T>C23% (30/132)Variable severity
m.9176T>C23% (30/132)Ataxia, cognitive dysfunction
m.9185T>C9% (12/132)Neuropathy, ataxia

These mutations affect ATP synthase function through several mechanisms:

  • Reduced ATP synthesis rate

  • Preserved ATP hydrolysis capacity

  • Abnormally increased mitochondrial membrane potential

  • Altered assembly or stability of the ATP synthase complex

Interestingly, no single biochemical feature is universally observed across all pathogenic variants, highlighting the complex nature of MT-ATP6-related diseases .

What is the relationship between heteroplasmy and disease severity in MT-ATP6 mutations?

The relationship between heteroplasmy (percentage of mutated mtDNA) and disease severity is complex. In a large cohort study of 132 MT-ATP6 mutation carriers from 11 countries, affected individuals showed a high degree of heteroplasmy (mean 95%, range 20%-100%), but asymptomatic carriers also showed considerable heteroplasmy (mean 73%, range 20%-100%) .

While symptomatic subjects had significantly higher heteroplasmy load than asymptomatic carriers (p=1.6×10^-39), there was substantial overlap . This suggests that heteroplasmy alone cannot reliably predict disease severity, and other factors likely influence phenotypic expression.

The age of symptom onset ranged from prenatal to 75 years, with nearly half of patients (48%) becoming symptomatic before their first birthday. In 28 deceased patients, the median age of death was 14 months, indicating the potential severity of these mutations .

How can RNA-binding properties of ATP synthase components be studied?

Recent research suggests RNA may play a role in mitochondrial import of ATP synthase components. To investigate this, researchers have developed RNA binding-deficient mutants (RBdef) of ATP5A1, a key component of ATP synthase.

The methodology includes:

This approach enables researchers to specifically investigate how RNA interactions affect the assembly, localization, and function of ATP synthase components, providing insights into novel mechanisms of mitochondrial protein import and complex assembly.

What are the phenotypic manifestations of MT-ATP6 mutations?

Clinical presentations of MT-ATP6 mutations vary widely, from asymptomatic to severe multisystemic disease. In a cohort of 132 mutation carriers, the most frequent symptoms were:

SymptomFrequency
Ataxia81%
Cognitive dysfunction49%
Neuropathy48%
Seizures37%
Retinopathy14%

A diagnosis of Leigh syndrome was made in 55% of patients, whereas the classic syndrome of neuropathy, ataxia, and retinitis pigmentosa (NARP) was rare (8%) .

Adult-onset patients often presented with oligosymptomatic manifestations, particularly ataxia or neuropathy, indicating the need to include MT-ATP6 mutations in the differential diagnosis of both conditions .

What are optimal approaches for detecting recombinant ATP synthase components?

For detecting recombinant ATP synthase components, researchers can utilize several validated approaches:

  • Western Blotting: Using specific antibodies like ATP5G1 Rabbit monoclonal antibody at dilutions of 1:2000-1:10000. This approach allows visualization of the protein at its expected molecular weight (~8kDa observed, 14kDa calculated) .

  • Immunofluorescence/Immunocytochemistry: Using conjugated antibodies such as Alexa Fluor® 488 Anti-ATP synthase C antibody at dilutions of 1:50-1:200. This enables subcellular localization studies of ATP synthase components .

  • ELISA: Quantitative detection of ATP synthase components using specific antibodies at optimized concentrations .

Storage recommendations for antibodies typically include keeping them at -20°C and avoiding freeze/thaw cycles. Buffer compositions generally include PBS with 0.02% sodium azide, 0.05% BSA, and 50% glycerol at pH 7.3 .

What methodologies are recommended for assessing MT-ATP6 variant pathogenicity?

Assessing the pathogenicity of MT-ATP6 variants remains challenging due to the lack of clinically available functional assays. Current approaches include:

Researchers are working to develop consistent biochemical diagnostic analyses to permit accurate pathogenicity assessment of variants of uncertain significance in MT-ATP6 .

How can researchers generate and validate RNA binding-deficient mutants of ATP synthase components?

To investigate the role of RNA in mitochondrial protein import and function, researchers can generate RNA binding-deficient mutants following these steps:

This methodological approach allows for targeted investigation of the role of RNA in ATP synthase function and mitochondrial biology more broadly.

What are the limitations in current MT-ATP6 research methods?

Despite advances in understanding MT-ATP6 function and related diseases, several methodological challenges persist:

  • Functional Assay Standardization: There is a lack of clinically available standardized functional assays for validating the pathogenicity of MT-ATP6 variants .

  • Heteroplasmy Interpretation: The extensive overlap in heteroplasmy levels between symptomatic and asymptomatic carriers complicates the interpretation of genetic findings .

  • Biochemical Heterogeneity: The diverse biochemical features associated with pathogenic MT-ATP6 variants make it difficult to establish definitive diagnostic criteria .

  • Phenotypic Variability: The wide clinical spectrum, ranging from asymptomatic to severe early-onset disease, challenges genotype-phenotype correlations .

Addressing these limitations will require improved mechanistic understanding and development of consistent biochemical diagnostic analyses to permit accurate pathogenicity assessment of variants of uncertain significance in MT-ATP6 .

What promising research directions may advance MT-ATP6 studies?

Several emerging approaches show promise for advancing MT-ATP6 research:

  • RNA-Protein Interaction Studies: Investigating the role of RNA in mitochondrial import and assembly of ATP synthase components may provide new insights into complex V biogenesis and function .

  • High-Resolution Structural Biology: Advanced techniques like cryo-electron microscopy can reveal detailed structures of ATP synthase components and their interactions, potentially elucidating mutation effects at the molecular level.

  • Mitochondrial Medicine: Development of targeted therapies for MT-ATP6-related disorders based on improved understanding of disease mechanisms.

  • Systems Biology Approaches: Integration of genomic, transcriptomic, proteomic, and metabolomic data to understand the broader impact of MT-ATP6 mutations on cellular function.

  • Gene Editing Technologies: Application of mitochondrial-targeted gene editing tools to correct pathogenic mutations or modulate heteroplasmy levels as potential therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.