Recombinant Rabbit C-X-C chemokine receptor type 1 (CXCR1)

Shipped with Ice Packs
In Stock

Description

Functional Role of CXCR1

CXCR1 binds chemokines with the ELR (glutamic acid-leucine-arginine) motif, primarily CXCL6 and CXCL8 (IL-8) in humans . Its signaling pathway involves G-protein activation, calcium mobilization, and β-arrestin-mediated receptor internalization . Key biological roles include:

  • Leukocyte Chemotaxis: Directs neutrophil migration in inflammation .

  • Tissue Repair: Facilitates liver regeneration post-ischemia/reperfusion injury .

  • Cancer Progression: Modulates tumor microenvironment interactions .

Therapeutic Potential in Cancer

CXCR1 overexpression enhances natural killer (NK) cell homing to IL-8-secreting tumors. Studies show:

  • Increased Tumor Infiltration: CXCR1-modified NK cells migrate 5-fold more toward tumor supernatants compared to controls .

  • Improved Antitumor Efficacy: In ovarian cancer models, CXCR1-expressing NK cells reduced tumor burden by ~50% .

Role in Liver Injury and Repair

CXCR1 expression peaks 96 hours post-reperfusion in murine liver models, localized to hepatocytes. It:

  • Promotes Liver Recovery: Facilitates hepatocyte regeneration without affecting acute injury .

  • Counteracts CXCR2 Activity: Antagonism of CXCR1/2 delays repair, suggesting distinct roles for CXCR1 in recovery .

Involvement in Retinal Pathology

In proliferative vitreoretinopathy (PVR), CXCR1 is upregulated in Müller cells, while CXCL8 and CXCR2 are expressed in microglia. This suggests a role in:

  • Glial Cell Activation: Müller cells respond to CXCL8 with calcium signaling, contributing to fibrotic responses .

Detection and Analysis Tools

Multiple antibodies target CXCR1 for research applications:

AntibodyHostEpitopeApplicationsReactivity
Polyclonal (CAB16386) RabbitAA 250–350WB, IHC-P, ELISAHuman, Mouse, Rat
Monoclonal (SE2) RabbitN-terminal (AA 1–30)Flow Cytometry, IHCHuman
Multiclonal (RP23040161) RabbitSynthetic peptide (human CXCR1)ICC/IFHuman

Production and Handling Guidelines

  • Reconstitution: Use deionized water (0.1–1.0 mg/mL). Add 5–50% glycerol for long-term storage (-20°C/-80°C) .

  • Stability: Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for ≤1 week .

Comparative Analysis of CXCR1 and CXCR2

FeatureCXCR1CXCR2
LigandsCXCL6, CXCL8 (high affinity)CXCL1, CXCL2, CXCL5–8 (broad affinity)
Recycling KineticsSlower recycling post-internalizationFaster recycling
Tissue ExpressionHepatocytes, Müller cells, NK cellsNeutrophils, endothelial cells, cancer cells

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR1; IL8RA; C-X-C chemokine receptor type 1; CXC-R1; CXCR-1; High affinity interleukin-8 receptor A; IL-8R A; CD antigen CD181
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MEVNVWNMTDLWTWFEDEFANATGMPPVEKDYSPCLVVTQTLNKYVVVVIYALVFLLSLL GNSLVMLVILYSRSNRSVTDVYLLNLAMADLLFALTMPIWAVSKEKGWIFGTPLCKVVSL VKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFICLGIWALSLILSLPFFLFR QVFSPNNSSPVCYEDLGHNTAKWRMVLRILPHTFGFILPLLVMLFCYGFTLRTLFQAHMG QKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTHVIQETCQRRNDIDRALDATEILGF LHSCLNPIIYAFIGQNFRNGFLKMLAARGLISKEFLTRHRVTSYTSSSTNVPSNL
Uniprot No.

Target Background

Function
CXCR1 is a receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor. Binding of IL-8 to CXCR1 triggers neutrophil activation, mediated through a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Database Links

KEGG: ocu:100328622

UniGene: Ocu.1917

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Neutrophils.

Q&A

What is CXCR1 and what are its primary functions in immune responses?

CXCR1 (C-X-C chemokine receptor type 1) is a G protein-coupled receptor that primarily functions as a receptor for interleukin-8 (IL-8), a powerful neutrophil chemotactic factor. The binding of IL-8 to CXCR1 triggers activation of neutrophils, playing a crucial role in immune response against pathogens. This activation is mediated through a G-protein that initiates a phosphatidylinositol-calcium second messenger system . CXCR1 signaling is essential for neutrophil migration, activation, and degranulation during inflammatory responses.

Methodologically, researchers can study CXCR1 function using:

  • Chemotaxis assays with isolated primary neutrophils or transfected cell lines

  • Calcium flux measurements to track receptor activation

  • FACS analysis to monitor receptor expression on immune cells

  • In vivo models of inflammation with CXCR1 inhibitors or genetic knockouts

How does the structure of CXCR1 relate to its function?

The 3D structure of CXCR1 has been resolved using nuclear magnetic resonance (NMR) spectroscopy (PDB: 2LNL), revealing three extracellular loops and three intracellular loops. The third intracellular loop is particularly important for signal transduction to G proteins . This structural information has enabled detailed understanding of ligand binding mechanisms.

The N-terminal domain of CXCR1 interacts electrostatically with the N loop of CXCL8 (IL-8), allowing the N-terminal ELR motif of CXCL8 to approach the extracellular loops of the receptor through hydrophobic interactions. Final binding stabilization occurs through electrostatic interactions . This structural arrangement is critical for proper signal transduction and receptor function.

To study structure-function relationships, researchers can:

  • Use site-directed mutagenesis to modify key residues

  • Employ fluorescence resonance energy transfer (FRET) to study conformational changes

  • Analyze receptor chimeras to identify critical domains

  • Utilize molecular dynamics simulations based on resolved structures

What are the optimal conditions for detecting CXCR1 in Western blot applications?

For successful Western blot detection of CXCR1, researchers should consider the following methodological approach:

  • Sample preparation:

    • Use fresh tissue/cells whenever possible

    • Include protease inhibitors in lysis buffers to prevent degradation

    • Consider membrane protein extraction protocols for optimal yield

  • Running conditions:

    • CXCR1 has a predicted band size of approximately 40 kDa

    • Use 10-12% polyacrylamide gels for optimal resolution

    • Include positive controls such as human fetal skin lysate

  • Antibody selection and dilution:

    • For rabbit polyclonal antibodies, a starting dilution of 1/500 is recommended

    • Verify antibody specificity using known positive samples

    • Consider antibodies targeting the N-terminal region (residues 24-38) for higher specificity

  • Detection optimization:

    • Extended blocking (1-2 hours) may reduce background

    • Overnight primary antibody incubation at 4°C can improve signal

    • Use enhanced chemiluminescence (ECL) detection for sensitive visualization

How should researchers validate antibody specificity for CXCR1 detection?

Proper validation of antibody specificity is crucial for reliable CXCR1 detection. A comprehensive validation approach includes:

  • Positive and negative controls:

    • Use tissues/cells known to express CXCR1 (e.g., human neutrophils) as positive controls

    • Include knockout/knockdown samples as negative controls when available

    • Compare multiple antibodies targeting different epitopes

  • Peptide competition assays:

    • Pre-incubate antibody with the immunizing peptide (e.g., the N-terminal sequence DEDYSPCMLETETLN for some antibodies)

    • Observe elimination of specific signal in Western blot or immunohistochemistry

  • Cross-reactivity testing:

    • Test antibody against related proteins (especially CXCR2)

    • Evaluate species cross-reactivity if working with non-human samples

  • Correlation with functional data:

    • Confirm that antibody reactivity correlates with functional measurements

    • Use neutralization assays to confirm antibody binding to the functional protein

What are the critical considerations for heterologous expression of recombinant CXCR1?

Heterologous expression of CXCR1 presents several challenges due to its nature as a membrane protein. Based on successful approaches in the literature, researchers should consider:

  • Expression system selection:

    • Insect cells (e.g., baculovirus-infected systems) have proven effective for CXCR1 expression with preserved functionality

    • Mammalian expression systems may provide more physiologically relevant post-translational modifications

    • E. coli systems typically require refolding and may not maintain native conformation

  • Construct design optimization:

    • Include affinity tags (e.g., Flag tag) for purification while minimizing interference with function

    • Consider fusion constructs (e.g., CXCR1-Gᵢ₂α fusion proteins) which can improve expression and stability

    • Codon optimization for the expression host may improve yield

  • Co-expression strategies:

    • Co-expression with G protein subunits (Gᵢ₂α, β, and γ) can significantly increase receptor expression levels

    • Studies have shown nearly 10-fold higher B_max values when CXCR1 is co-produced with G protein in insect cells

  • Functional validation:

    • Confirm ligand binding using radioligand binding assays (e.g., ¹²⁵I-labeled IL-8)

    • Verify G protein coupling through guanyl-5'-yl imidodiphosphate (Gpp(NH)p) sensitivity tests

    • Analyze pharmacological profiles to ensure they match profiles of native receptors

How can researchers effectively differentiate between CXCR1 and CXCR2 signaling?

Distinguishing between CXCR1 and CXCR2 signaling is challenging due to overlapping ligand specificity and signaling pathways. Effective experimental approaches include:

  • Selective ligand utilization:

    • CXCL8/IL-8 binds both receptors with high affinity

    • CXCL1 and CXCL6 show attenuated intracellular cAMP and Ca²⁺ signaling compared to CXCL8 stimulation

    • Use receptor-selective ligands or blocking antibodies where available

  • Receptor-specific readouts:

    • Monitor differences in internalization and recycling kinetics, as CXCR1 and CXCR2 differ in their recycling characteristics

    • Analyze downstream signaling pathway activation with phospho-specific antibodies

    • Measure differences in gene expression profiles induced by each receptor

  • Genetic approaches:

    • siRNA/shRNA knockdown of specific receptors

    • CRISPR/Cas9-mediated receptor knockout

    • Selective expression of each receptor in receptor-negative cell lines

  • Pharmacological discrimination:

    • Apply receptor-selective antagonists

    • Use neutralizing antibodies with verified selectivity for CXCR1 versus CXCR2

    • Analyze differential sensitivity to inhibitors of downstream signaling components

What methods are most effective for studying CXCR1 receptor internalization dynamics?

CXCR1 receptor internalization is a critical aspect of receptor regulation and signaling. To study this process effectively:

  • Real-time imaging approaches:

    • Fluorescently tagged CXCR1 constructs for live-cell imaging

    • TIRF microscopy to visualize membrane-proximal events

    • Confocal microscopy with time-lapse imaging to track receptor movement

  • Biochemical quantification:

    • Cell surface biotinylation followed by streptavidin pull-down to measure remaining surface receptors

    • Flow cytometry with fluorescently labeled antibodies to quantify surface receptor levels

    • Radioligand binding assays to measure accessible receptor populations

  • Investigation of internalization machinery:

    • Co-immunoprecipitation studies to detect interactions with β-arrestin, GRKs, and AP-2 adaptor proteins

    • siRNA knockdown of clathrin, β-arrestin, and GRKs to determine their contributions

    • Pharmacological inhibitors of endocytic pathways (e.g., dynasore for dynamin inhibition)

  • Analysis of receptor fate:

    • Pulse-chase experiments to track receptor recycling versus degradation

    • Co-localization studies with endosomal markers (early endosomes, recycling endosomes, lysosomes)

    • Western blot analysis of receptor levels after stimulation with various concentrations of ligand

It's important to note that in vitro experiments typically use soluble chemokines, while in vivo chemokines are often immobilized on endothelial cells, which may influence receptor internalization dynamics .

How do immobilized versus soluble chemokines affect CXCR1 function and experimental design?

The contextual presentation of chemokines significantly impacts CXCR1 signaling and function, with important implications for experimental design:

  • Differential receptor activation:

    • Soluble chemokines used in most in vitro experiments may not fully recapitulate in vivo receptor behavior

    • Evidence suggests receptor internalization occurs primarily at high concentrations of chemokines

    • Immobilized chemokines (e.g., on endothelial cells) may trigger different patterns of receptor internalization and signaling

  • Experimental approaches to study immobilized chemokine effects:

    • Culture systems with chemokines immobilized on extracellular matrix components

    • Microfluidic devices with chemokine-coated surfaces to mimic physiological gradients

    • Co-culture systems with endothelial cells expressing chemokines

    • In vivo migration studies with intravital microscopy

  • Methodological considerations:

    • When comparing soluble versus immobilized chemokine effects, standardization of chemokine concentration/density is critical

    • Time-course experiments are essential as kinetics may differ dramatically

    • Readouts should include both receptor signaling (e.g., calcium flux) and functional responses (e.g., migration)

  • Analytical framework:

    • Incorporate both short-term (seconds to minutes) and long-term (hours) measurements

    • Consider gradient stability in different experimental systems

    • Account for matrix interactions that may affect chemokine availability and presentation

What are the key considerations for developing effective CXCR1-targeted therapeutics?

Developing therapeutics targeting CXCR1 requires understanding of several critical factors:

  • Receptor selectivity challenges:

    • High homology between CXCR1 and CXCR2 makes selective targeting difficult

    • Dual inhibition may be desirable in some disease contexts but problematic in others

    • Structural analysis of binding pockets can guide selective inhibitor design

  • Target validation strategies:

    • Disease-specific expression and activation patterns must be established

    • Genetic association studies can identify relevant patient populations

    • Animal models with genetic or pharmacological inhibition provide proof-of-concept

  • Therapeutic modality selection:

    • Small molecule antagonists may provide oral bioavailability but face selectivity challenges

    • Biologics (antibodies) offer high specificity but limited tissue penetration

    • Peptide inhibitors derived from natural ligands can balance specificity and bioavailability

  • Efficacy assessment approaches:

    • Functional assays measuring chemotaxis inhibition in vitro

    • Receptor occupancy studies using competitive binding assays

    • Pathway inhibition measurements (calcium flux, ERK phosphorylation)

    • In vivo models of inflammatory disease with relevant biomarkers

  • Potential therapeutic applications:

    • Inflammatory diseases where neutrophil recruitment drives pathology

    • Cancer contexts where CXCR1/2 play roles in angiogenesis

    • Fibrotic conditions with chemokine involvement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.