Recombinant Rabbit C-X-C chemokine receptor type 2 (CXCR2)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

CXCR2 is critical in inflammatory and angiogenic processes:

  • Neutrophil Chemotaxis: Mediates migration of neutrophils to inflammation sites via ELR+ CXC chemokines (e.g., IL-8, GRO-β) .

  • Angiogenesis: Promotes endothelial cell chemotaxis in response to ELR+ chemokines, a process blocked by CXCR2-neutralizing antibodies .

  • Signal Transduction: Activates calcium mobilization and phosphatidylinositol-calcium pathways upon ligand binding .

Key Functional Data:

  • In rabbit models, a CXCR2 antagonist (IC₅₀ = 7.7 nM for calcium flux inhibition) reduced synovial fluid leukocytes by >95% in IL-8-induced arthritis .

  • CXCR2 knockdown impaired corneal neovascularization in mice, confirming its role in angiogenesis .

Therapeutic Implications

CXCR2 is a target for inflammatory and autoimmune diseases:

  • Arthritis Models: Oral administration of a CXCR2 antagonist (25 mg/kg, twice daily) reduced neutrophils, monocytes, and proinflammatory mediators (TNF-α, IL-8, PGE₂) in rabbit LPS- and OVA-induced arthritis .

  • Cancer: CXCR2 overexpression correlates with tumor progression via angiogenesis and immune cell infiltration .

Comparative Analysis with Human CXCR2

Rabbit CXCR2 shares functional homology with human CXCR2:

  • Ligand Specificity: Binds human IL-8 with high affinity (Kₐ = 0.1 nM) .

  • Antagonist Cross-Reactivity: A human CXCR2-selective antagonist inhibited rabbit CXCR2-mediated chemotaxis (IC₅₀ = 0.75 nM) .

  • Sequence Identity: 80% amino acid similarity to human CCR2b, with conserved cysteine residues critical for disulfide bonding .

Research Tools and Reagents

Commercial reagents enable CXCR2 study:

ProductHostApplicationsTarget EpitopeSource
Recombinant CXCR2 ProteinE. coliSDS-PAGE, Binding AssaysFull-length (1-358aa) with His tagCreative BioMart
Anti-CXCR2 Antibody (CAB3301)RabbitWB, IHC, IF/ICCAmino acids 260-359 (C-terminal domain)Assay Genie
Anti-CXCR2 Antibody (R-1048)RabbitWBPeptide region 196-212Biosensis

Future Directions

  • Drug Development: Small-molecule antagonists (e.g., TAK-779) show promise in preclinical rabbit models .

  • Structural Studies: Cryo-EM could resolve ligand-binding dynamics for targeted therapy.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR2; IL8RB; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MQEFTWENYSYEDFFGDFSNYSYSTDLPPTLLDSAPCRSESLETNSYVVLITYILVFLLS LLGNSLVMLVILYSRSTCSVTDVYLLNLAIADLLFATTLPIWAASKVHGWTFGTPLCKVV SLVKEVNFYSGILLLACISVDRYLAIVHATRTMIQKRHLVKFICLSMWGVSLILSLPILL FRNAIFPPNSSPVCYEDMGNSTAKWRMVLRILPQTFGFILPLLVMLFCYVFTLRTLFQAH MGQKHRAMRVIFAVVLIFLLCWLPYNLVLLTDTLMRTHVIQETCERRNDIDRALDATEIL GFLHSCLNPIIYAFIGQKFRYGLLKILAAHGLISKEFLAKESRPSFVASSSGNTSTTL
Uniprot No.

Target Background

Function
CXCR2 is a receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor. Binding of IL-8 to CXCR2 activates neutrophils. This activation is mediated through a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. It also exhibits high affinity binding to CXCL3, GRO/MGSA, and NAP-2.
Database Links

KEGG: ocu:100328627

UniGene: Ocu.1988

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed preferentially in neutrophils.

Q&A

What is CXCR2 and why is rabbit CXCR2 important in preclinical research?

CXCR2 (C-X-C Chemokine Receptor Type 2) is a G protein-coupled receptor that primarily binds to chemokines like interleukin-8 (IL-8), growth-related protein α (Gro-α), and other CXC chemokines. The receptor plays a critical role in neutrophil chemotaxis and activation, where binding of IL-8 to the receptor causes activation of neutrophils via a G-protein that triggers a phosphatidylinositol-calcium second messenger system .

Rabbit models have been widely used to study inflammatory processes. The importance of rabbit CXCR2 in preclinical research stems from the challenge of developing cross-species active small molecule antagonists. Understanding rabbit CXCR2 provides valuable tools for toxicology and efficacy studies in rabbit models of inflammatory diseases such as arthritis, making it an essential component for translational research .

How does rabbit CXCR2 compare structurally to human CXCR2?

While detailed sequence alignment data for rabbit CXCR2 compared to human CXCR2 isn't explicitly provided in the search results, we can draw parallels from related chemokine receptors. For instance, rabbit CCR2 shares 80% identity with human CCR2b .

The human CXCR2 receptor has a predicted length of 360 residues and a molecular weight of 41 kDa . The binding site for IL-8 on human CXCR2 appears to be discontinuous, with contact regions at the N-terminus, extracellular loop 1 (ECL1), and extracellular loop 3 (ECL3) . This structural information helps researchers design experiments targeting specific domains of the rabbit CXCR2 protein.

What are the primary ligands for rabbit CXCR2?

Rabbit CXCR2 binds to several chemokines, with IL-8 being a principal ligand. Studies demonstrate that human IL-8 effectively binds to and activates rabbit CXCR2. In experimental settings, both human IL-8 and mouse JE (murine MCP-1) have been shown to induce rabbit CXCR2-mediated responses .

How can recombinant rabbit CXCR2 be cloned and expressed effectively?

Based on similar approaches used for rabbit CCR2, the recommended methodology for cloning recombinant rabbit CXCR2 would involve:

  • RNA Extraction: Isolate total RNA from rabbit tissues with high CXCR2 expression (likely spleen, lung, or neutrophils).

  • PCR-Based Cloning: Use specific primers designed based on conserved regions of CXCR2 across species to amplify the full-length cDNA.

  • Vector Construction: Clone the PCR product into an appropriate expression vector (e.g., retroviral or lentiviral vectors for stable cell line generation).

  • Cell Transfection: Establish stable transfectants in appropriate cell lines such as U-937 cells, which have been successfully used for rabbit CCR2 expression .

  • Validation: Confirm expression through Western blot analysis and functional assays such as calcium mobilization or chemotaxis assays.

This approach ensures the generation of functional recombinant CXCR2 that maintains ligand binding and signaling capabilities.

What methodologies are most effective for studying rabbit CXCR2-ligand interactions?

Several complementary approaches provide comprehensive analysis of CXCR2-ligand interactions:

  • Radioligand Binding Assays: Use radiolabeled ligands such as 125I-labeled IL-8 to determine binding kinetics (Kd values) and receptor densities. For instance, with rabbit CCR2, 125I-mouse JE has been used with a calculated Kd of 0.1 nM .

  • Competition Binding Assays: Measure displacement of radiolabeled ligands by unlabeled potential competitors to determine relative binding affinities.

  • Calcium Mobilization Assays: Measure intracellular calcium flux following receptor activation using calcium-sensitive fluorescent dyes.

  • Chemotaxis Assays: Quantify cell migration in response to concentration gradients of chemokines to assess functional responses. For rabbit neutrophils, human IL-8-induced chemotaxis has been potently inhibited by CXCR2 antagonists with an IC50 of 0.75 nM .

  • NanoBiT Complementation Assay: For more advanced studies, this technique measures CXCL8-stimulated recruitment of β-arrestin2 to the CXCR2 receptor through proximity complementation of tags that regenerate functional nanoluciferase .

How can a stable cell line expressing recombinant rabbit CXCR2 be established and validated?

Establishing a stable cell line expressing recombinant rabbit CXCR2 requires the following methodological approach:

  • Selection of Appropriate Cell Line: Human cell lines like U-937 or HEK293 cells provide good platforms for heterologous expression of rabbit CXCR2.

  • Vector Design: Construct an expression vector containing the rabbit CXCR2 coding sequence under a strong promoter, along with a selection marker (e.g., antibiotic resistance or fluorescent reporter).

  • Transfection and Selection: Transfect cells using lipofection, electroporation, or viral transduction methods, followed by antibiotic selection to isolate stably transfected clones.

  • Single Cell Cloning: Isolate individual clones through limiting dilution to ensure uniform expression.

  • Validation Steps:

    • Western blotting using anti-CXCR2 antibodies that recognize conserved epitopes

    • Flow cytometry to quantify surface expression levels

    • Radioligand binding assays to confirm functional binding

    • Calcium mobilization assays to verify signal transduction

    • Chemotaxis assays to assess functional responses

Successful validation would demonstrate both receptor expression and functional signaling capacity in response to known CXCR2 ligands.

How does one measure CXCR2-mediated signal transduction in rabbit cells?

CXCR2-mediated signal transduction in rabbit cells can be assessed through multiple complementary approaches:

  • Calcium Mobilization: Measure intracellular calcium flux following receptor activation using fluorescent calcium indicators such as Fura-2 or Fluo-4. Human IL-8-induced calcium mobilization mediated by rabbit CXCR2 has been reported with an IC50 of 7.7 nM for antagonist studies .

  • β-arrestin Recruitment: Utilize NanoBiT complementation assays where receptor-arrestin interaction is detected by proximity complementation of tags that regenerate functional nanoluciferase in response to CXCL8 stimulation .

  • ERK/MAPK Phosphorylation: Western blot analysis of phosphorylated ERK following CXCR2 stimulation indicates activation of the MAPK pathway.

  • cAMP Assays: Measure changes in intracellular cAMP levels using ELISA or FRET-based sensors to assess G-protein coupling.

  • Receptor Internalization: Quantify receptor internalization following agonist stimulation using fluorescently labeled antibodies or tagged receptors.

These assays provide a comprehensive profile of rabbit CXCR2 signaling dynamics and can be used to compare the potency of various ligands or antagonists.

What are the key differences in signaling between rabbit CXCR2 and CXCR1?

While detailed comparative data for rabbit CXCR1 and CXCR2 signaling is limited in the provided search results, some key differences can be inferred:

  • Ligand Selectivity: Studies with selective CXCR2 antagonists demonstrate significant differences in binding affinity between rabbit CXCR1 and CXCR2. A selective antagonist of human CXCR2 potently inhibited human IL-8 binding to rabbit CXCR2 (IC50 = 40.5 nM) but not to rabbit CXCR1 (IC50 = >1000 nM) .

  • Calcium Mobilization: The same antagonist showed differential effects on human IL-8-induced calcium mobilization mediated by rabbit CXCR2 (IC50 = 7.7 nM) versus rabbit CXCR1 (IC50 = 2200 nM) .

  • Expression Patterns: While both receptors may be expressed in inflammatory conditions, their relative expression levels may differ. In a UUO (unilateral ureteral obstruction) mouse model, CXCR2 inhibition via SB225002 did not affect CXCR1 protein levels, suggesting different regulatory mechanisms .

These differences highlight the importance of receptor selectivity in experimental design and interpretation when studying chemokine signaling in rabbit models.

How do antagonists differentially affect rabbit CXCR2 function compared to human CXCR2?

Several studies have characterized the effects of CXCR2 antagonists on rabbit CXCR2 compared to human CXCR2:

  • Cross-Species Activity: A selective nonpeptide antagonist of human CXCR2 has demonstrated potent inhibition of rabbit CXCR2, suggesting significant conservation of the antagonist binding site between species .

  • Binding Potency: The dual CCR2/CCR5 antagonist TAK-779 effectively inhibits 125I-mouse JE binding to rabbit CCR2 with an IC50 of 2.3 nM, demonstrating that some antagonists maintain high potency across species .

  • Functional Antagonism: A CXCR2 antagonist potently inhibited human IL-8-induced chemotaxis of rabbit neutrophils with an IC50 of 0.75 nM, indicating that functional antagonism translates well between species .

  • In Vivo Efficacy: Administration of a human CXCR2-selective antagonist at 25 mg/kg twice daily significantly reduced inflammatory responses in rabbit arthritis models, confirming that pharmacological targeting of rabbit CXCR2 is feasible with compounds developed against the human receptor .

This cross-species activity makes the rabbit a valuable preclinical model for testing CXCR2 antagonists intended for human therapeutic applications.

How effective are rabbit models for studying CXCR2 in inflammatory diseases?

Rabbit models have proven highly effective for studying CXCR2 in inflammatory diseases for several reasons:

  • Arthritis Models: Rabbit models of arthritis induced by IL-8, LPS, or OVA have demonstrated the significant role of CXCR2 in joint inflammation. Administration of a CXCR2 antagonist significantly reduced synovial fluid neutrophils, monocytes, and lymphocytes in these models .

  • Inflammatory Mediator Profile: In LPS- and OVA-induced arthritis rabbit models, CXCR2 antagonism reduced levels of pro-inflammatory mediators including TNF-alpha, IL-8, PGE2, leukotriene B4, and leukotriene C4 in synovial fluid, along with decreased serum TNF-alpha and IL-8 levels .

  • Infection Models: Rabbit models infected with syphilis have been used to study CXCR2-siRNA interventions. A recombinant plasmid with CXCR2-siRNA showed significant therapeutic effect in rabbits with syphilis infections of the testicle and eye .

  • Cross-Species Pharmacology: Selective human CXCR2 antagonists maintain activity against rabbit CXCR2, making the rabbit an appropriate species to examine anti-inflammatory effects of human CXCR2-selective antagonists .

These characteristics make rabbit models valuable for translational research on CXCR2-targeted therapies for inflammatory diseases.

What role does CXCR2 play in rabbit models of infection and inflammation?

CXCR2 plays multifaceted roles in rabbit models of infection and inflammation:

  • Neutrophil Recruitment: CXCR2 mediates the chemotactic migration of neutrophils to sites of inflammation in response to IL-8 and related chemokines. Inhibition of CXCR2 with a selective antagonist potently inhibited human IL-8-induced chemotaxis of rabbit neutrophils (IC50 = 0.75 nM) .

  • Inflammatory Cascade Amplification: In rabbit arthritis models, CXCR2 signaling contributes to the production of pro-inflammatory mediators including TNF-alpha, IL-8, and leukotrienes, creating a positive feedback loop that amplifies inflammation .

  • Infection Response: In syphilis-infected rabbit models, CXCR2 appears to play a role in the pathogenesis. Intervention with CXCR2-siRNA reduced clinical manifestations including chancre, testis swelling, orchitis, fur damage, and lymphadenitis .

  • Tissue Damage: The inflammatory processes mediated by CXCR2 contribute to tissue destruction in chronic inflammatory conditions, as evidenced by the protective effects of CXCR2 antagonism in arthritis models .

These roles highlight CXCR2 as a central mediator in the initiation and propagation of inflammatory responses in rabbit disease models.

How can recombinant CXCR2-siRNA constructs be utilized in rabbit disease models?

Recombinant CXCR2-siRNA constructs offer powerful tools for investigating CXCR2 function in rabbit disease models:

  • Vector Construction: The synthetic CXCR2-siRNA can be linked with plasmids such as pDC316-EGFP-U6 using ligase to create a reconstruction plasmid. This can be further modified with cholesterol to enhance stability and cellular uptake .

  • Delivery Methods: The recombinant plasmid can be delivered in vivo through various approaches:

    • Direct tissue injection

    • Liposome-based delivery systems

    • Cholesterol-modified plasmids for enhanced cellular uptake

    • Viral vector-based delivery for stable expression

  • Efficacy Assessment: In a rabbit syphilis model, the recombinant plasmid with CXCR2-siRNA demonstrated significant therapeutic effects after 28 days of treatment, with statistical significance (P<0.01) compared to control groups .

  • Monitoring Expression: The inclusion of reporter genes like EGFP allows for visualization of transfection efficiency. In previous studies, cellular ratios with green fluorescent protein reached 10%, indicating successful transfection of the recombinant plasmid .

This approach provides a powerful method for investigating the specific role of CXCR2 in disease pathogenesis and evaluating the therapeutic potential of CXCR2 inhibition.

How do CXCR2 signaling pathways intersect with β-catenin signaling in inflammatory conditions?

Recent research has revealed complex interactions between CXCR2 and β-catenin signaling pathways:

  • Co-localization: Studies have shown that CXCR2 co-localizes with β-catenin in cellular models, suggesting a direct or indirect interaction between these signaling components. Active β-catenin has been observed to be co-localized with CXCR2 .

  • Reciprocal Regulation: CXCR2 appears to promote β-catenin signaling, as inhibition of CXCR2 via SB225002 significantly reduced the expression of active β-catenin in a UUO mice model .

  • Mitochondrial Function: CXCR2 signaling affects mitochondrial function, potentially through β-catenin-mediated pathways. CXCR2 inhibition preserved the expression of mitochondrial markers such as TOMM20 and CPT1A, while simultaneously suppressing β-catenin activation .

  • Cellular Senescence: CXCR2 accelerates tubular cell senescence via β-catenin-induced mitochondrial dysfunction. Overexpression of CXCR2 activated β-catenin signaling and inhibited the mitochondrial biogenesis regulator PGC-1α .

  • Intervention Efficacy: Treatment with ICG-001, a β-catenin inhibitor, effectively blocked CXCR2-induced fibrosis and tubular senescence, and restored mitochondrial function, confirming the mechanistic link between these pathways .

These findings highlight the importance of considering β-catenin as a downstream mediator of CXCR2 effects in inflammatory conditions and suggest potential for combination therapies targeting both pathways.

What approaches are most effective for developing functional monoclonal antibodies against rabbit CXCR2?

Developing functional monoclonal antibodies against rabbit CXCR2 presents significant challenges due to the complex structure of GPCRs. The most effective approaches include:

  • Epitope-Guided Selection: Identifying the ligand binding sites of CXCR2 through peptide library screening. Four major hCXCR2 regions have been identified as strong IL-8 binding sequences, including regions of the N-terminus and extracellular loops (ECL1) and combinations of ECL1/ECL3 and N-terminus/ECL1/ECL3 .

  • Synthetic Peptide Construction: Synthesizing peptides that mimic CXCR2 domains involved in IL-8 binding. This includes:

    • N-terminal sequence combined with ECL3 sequence

    • Peptides tethered by either a disulfide bridge or a CLIPS™ moiety

    • Combinations of N-term-ECL1-ECL2 constructs

  • Phage Display Technology: A multi-step approach for antibody development:

    • Using synthetic peptides as antigens to probe antibody fragment phage display libraries

    • Enriching phage populations binding to the IL-8 binding site of CXCR2

    • Further selection with CXCR2 overexpressing cells as a different antigen source

    • Converting scFvs from specific phage clones into monoclonal antibodies

  • Validation Strategies:

    • Binding assays with CXCR2-expressing cells

    • IL-8 and Gro-α induced β-arrestin recruitment inhibition assays

    • Neutrophil chemotaxis inhibition tests

This combined approach has successfully yielded functional monoclonal antibodies against CXCR2 that specifically bind to the receptor and inhibit ligand-induced responses .

How can fluorescent CXCR2 ligands be designed for advanced imaging studies in rabbit models?

Designing fluorescent CXCR2 ligands for advanced imaging in rabbit models requires a sophisticated approach:

  • Rational Design Strategy:

    • Start with a high-affinity CXCR2 ligand (like navarixin) as a molecular scaffold

    • Identify appropriate attachment points for fluorophores using computational approaches

    • Model ligand-target interactions to preserve critical binding residues

  • Structure-Based Modifications:

    • Use molecular docking to predict binding poses of the parent compound

    • Identify regions where fluorophore attachment won't disrupt key interactions

    • Validate methodology by accurately redocking known ligands into CXCR2 crystal structures (such as PDB: 6LFL)

  • Fluorophore Selection and Conjugation:

    • Choose fluorophores with appropriate spectral properties for intended imaging applications

    • Incorporate suitable linkers between the ligand and fluorophore to minimize steric hindrance

    • Consider photostability, quantum yield, and potential background fluorescence in tissues

  • Pharmacological Validation:

    • Assess binding affinity of fluorescent conjugates compared to parent compounds

    • Evaluate functional activity through NanoBiT complementation assays measuring CXCL8-stimulated recruitment of β-arrestin2

    • Confirm specificity through competition assays with unlabeled ligands

  • Imaging Application Optimization:

    • Test cellular uptake and subcellular localization

    • Evaluate tissue penetration and background signal in rabbit models

    • Adjust dosing and imaging parameters for optimal signal-to-noise ratio

This methodological approach ensures the development of fluorescent ligands that maintain high affinity and specificity for rabbit CXCR2 while providing robust imaging capabilities for advanced in vivo studies.

How does rabbit CXCR2 tissue distribution compare with other species?

While specific data on rabbit CXCR2 tissue distribution is limited in the provided search results, we can draw insights from related chemokine receptors and other species:

TissueRabbit CXCR2Rabbit CCR2Human CXCR2Mouse CXCR2
SpleenHigh (inferred)AbundantModerateModerate
LungHigh (inferred)AbundantHighHigh
BrainLow (inferred)LowLowLow
HeartLow (inferred)LowLowLow
LiverLow (inferred)LowLowModerate
TestisUnknownLowModerateLow
KidneyUnknownUnknownModerateModerate
NeutrophilsHigh (inferred)LowVery HighVery High

The pattern of rabbit CCR2 expression shows abundance in spleen and lung compared to low levels in brain, heart, liver, and testis . Given the functional similarities between chemokine receptors, rabbit CXCR2 likely follows a similar pattern with predominant expression in immune tissues and cells involved in inflammatory responses.

For comprehensive mapping of rabbit CXCR2 tissue distribution, quantitative PCR analysis or immunohistochemistry studies targeting rabbit CXCR2 would be necessary.

What are the key experimental considerations when transitioning from human to rabbit CXCR2 research models?

Researchers transitioning from human to rabbit CXCR2 models should consider the following key experimental aspects:

  • Ligand Cross-Reactivity:

    • Human IL-8 effectively binds to and activates rabbit CXCR2

    • Validate binding affinities of other CXC chemokines to rabbit CXCR2

    • Consider species-specific differences in ligand potency

  • Antagonist Pharmacology:

    • Many human CXCR2 antagonists retain activity against rabbit CXCR2

    • Determine IC50 values specifically for rabbit CXCR2 to enable proper dosing

    • Be aware that selectivity profiles may differ between species

  • Experimental Readouts:

    • Ensure antibodies for detection of rabbit CXCR2 have confirmed cross-reactivity

    • Validate functional assays (calcium flux, chemotaxis) with positive controls

    • Consider species-specific baseline levels for cytokine production

  • Model Selection:

    • Acute models: IL-8 or LPS-induced inflammation

    • Chronic models: antigen-induced arthritis

    • Design appropriate controls considering rabbit-specific immune responses

  • Delivery Methods:

    • Optimize transfection methods for rabbit cells

    • Consider tissue-specific delivery approaches

    • Validate expression systems in rabbit-derived tissues or cells

By addressing these considerations, researchers can ensure robust and translatable results when working with rabbit CXCR2 models.

What are the emerging strategies for targeting CXCR2 in inflammatory disease models?

Several innovative approaches for targeting CXCR2 in inflammatory disease models are emerging:

  • RNA Interference Technologies:

    • Recombinant plasmids containing CXCR2-siRNA have shown efficacy in rabbit models

    • Cholesterol-modified plasmids enhance stability and cellular uptake

    • Vector systems combining EGFP markers allow monitoring of transfection efficiency

  • Bispecific Antibody Development:

    • Antibodies targeting both CXCR2 and inflammatory mediators

    • Epitope-guided selection approaches for identifying functional binding domains

    • Combined phage display and cell-based selection methods

  • Allosteric Modulators:

    • Development of negative allosteric modulators (NAMs) like navarixin derivatives

    • Fluorescent ligands for visualizing receptor-ligand interactions

    • Structure-based design using crystallographic data

  • Pathway-Specific Interventions:

    • Targeting CXCR2-β-catenin signaling interface

    • Mitochondrial protection strategies to counter CXCR2-induced dysfunction

    • Combined inhibition of CXCR2 and downstream effectors like β-catenin

  • Precision Delivery Systems:

    • Cell-specific targeting of CXCR2 antagonists

    • Nanoparticle-based delivery of CXCR2 modulators

    • Temporal control of CXCR2 inhibition to minimize side effects

These emerging strategies offer promising approaches for more effective and selective modulation of CXCR2 signaling in inflammatory diseases.

How might CXCR2 interactions with mitochondrial function be exploited therapeutically?

Recent research revealing CXCR2's role in mitochondrial dysfunction opens novel therapeutic possibilities:

  • Mechanistic Understanding:

    • CXCR2 signaling negatively impacts mitochondrial function, potentially through β-catenin-mediated pathways

    • CXCR2 inhibition preserves mitochondrial markers such as TOMM20 and CPT1A

    • CXCR2 expression shows an inverse relationship with mitochondrial markers in disease models

  • Therapeutic Targeting Strategies:

    • Dual inhibition of CXCR2 and β-catenin pathways for synergistic mitochondrial protection

    • Development of compounds that specifically block CXCR2-mediated mitochondrial dysfunction

    • Combination therapies targeting CXCR2 with mitochondrial protective agents

  • Disease Applications:

    • Kidney fibrosis: CXCR2 inhibition via SB225002 preserved mitochondrial mass in UUO mouse models

    • Tubular cell senescence: Blocking CXCR2 prevented mitochondrial dysfunction and subsequent cellular senescence

    • Inflammatory conditions: Preserving mitochondrial function might reduce tissue damage from oxidative stress

  • Biomarker Development:

    • Mitochondrial function parameters as readouts for CXCR2-targeted therapy efficacy

    • Combined assessment of CXCR2, β-catenin, and mitochondrial markers for patient stratification

    • Monitoring of mitochondrial health as a surrogate endpoint in preclinical and clinical studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.