Recombinant Rabbit Calcitonin receptor (CALCR)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Applications

Recombinant CALCR is expressed in heterologous systems (e.g., HEK293T cells) for functional studies:

  • RAMP Co-Expression: CALCR requires RAMPs for ligand-specific responses. For example, CALCR+RAMP1 forms AMY1(a), which binds CGRP with high affinity .

  • Antibody Development: Rabbit-derived monoclonal antibodies (e.g., ab313335) detect CALCR in transfected cells and tissues (e.g., hypothalamus) .

Mechanistic Insights from Recombinant Models

  • Viral Pathogenesis: CALCR activation by amylin reduces HSV-1 replication in transfected HEK293T cells, suggesting a role in antiviral responses .

  • Bone Homeostasis: CALCR deficiency in mice increases bone resorption markers (Acp5, Ctsk) and impairs cartilage repair (Col1a1, Col2a1) .

  • Neuronal Signaling: CALCR neurons in the nucleus tractus solitarius (NTS) suppress feeding without aversion, distinct from Cck neurons .

Experimental Tools and Assays

  • Western Blot: Detects CALCR at ~55–70 kDa in rat brain, hypothalamus, and transfected cells .

  • Immunohistochemistry: Validates CALCR expression in paraffin-embedded tissues (e.g., thymus) .

  • DREADD Activation: Chemogenetic tools (e.g., hM3Dq) enable selective modulation of CALCR neurons in vivo .

Therapeutic and Research Implications

  • Metabolic Disorders: CALCR agonists (e.g., salmon calcitonin) suppress feeding via NTS neurons, offering potential anti-obesity targets .

  • Arthritis: CALCR knockout mice exhibit exacerbated bone loss in collagen-induced arthritis, highlighting its protective role in inflammation .

  • Social Behavior: CALCR in the medial preoptic area modulates affiliative behaviors in female mice, linking peptidergic signaling to social circuits .

Limitations and Unresolved Questions

  • Species Variability: Human CALCR shows weaker antibody reactivity than rat/mouse isoforms .

  • Splice Variant Effects: Δe13 impairs CALCR trafficking, but its physiological role remains unclear .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requirements. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery information, please consult your local distributors.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form retains its efficacy for 6 months at -20°C/-80°C. Lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal preservation for multiple uses, aliquotting is strongly recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. Should you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
CALCR; Calcitonin receptor; CT-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-474
Protein Length
Full Length of Mature Protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
NPASSNDTHPTVEPEPFLYVIGRKKLMDAQYKCYDRMEQLPPYQGEGPYCNRTWDGWMCW DDTPAGVLGFQYCPDYFPDFDPTEKVTKYCDETGVWFKHPGNNQTWSNYTMCNAFTPEKL QNAYVLYYLAIVGHSLSIFTLVISLGIFKCFRSLGCQRVTLHKNMFLTYILNSMIIIIHL VEVVPNGELVRRDPVSCKVLHFFHQYMMSCNYFWMLCEGIYLHTLIVVAVFAKQQHLRWY YLLGWGFPLVPTTIHAITRAIYFNDNCWMSVETHLLYIIHGPVMAALVVNFFFLLNIVRV LVTKMRETLEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKILGKIYDYLMHSLIHF QGFFVATIYCFCNNEVQTTVKRQWVQFKIQWNQRWGRRPAHRSVSRTAASAEEGGIPVYI YHQEPRNDPAHSLGEEGAEIIPLNIIEQESSA
Uniprot No.

Target Background

Function
This receptor functions as a mediator for calcitonin. Its activity is regulated by G proteins that activate adenylyl cyclase. The calcitonin receptor is believed to couple with the heterotrimeric guanosine triphosphate-binding protein, sensitive to cholera toxin. Isoform 2 exhibits altered ligand binding and a complete absence of coupling to phospholipase C.
Database Links

UniGene: Ocu.2121

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1 and isoform 2 are expressed in a tissue-specific manner, with isoform 2 accounting for less than 15% of the total calcitonin receptor mRNA in osteoclasts, kidney, and brain, but comprising at least 50% of the transcripts in skeletal muscle and l

Q&A

What is the calcitonin receptor (CALCR) and what is its molecular structure?

The calcitonin receptor (CALCR) is a seven-transmembrane domain G protein-coupled receptor that binds the protein hormone calcitonin . It belongs to the class B G protein-coupled receptor family and is expressed in various tissues including kidneys, central and peripheral nervous system, skeletal muscle stem cells, and osteoclasts . CALCR has a molecular weight of approximately 70 kDa and exists in multiple isoforms due to alternative splicing . The receptor's structure consists of an extracellular N-terminal domain (ECD) that is crucial for ligand binding, seven transmembrane domains connected by intracellular and extracellular loops, and an intracellular C-terminal domain involved in signaling cascades.

When activated by ligand binding, CALCR undergoes a conformational change that triggers signaling via guanine nucleotide-binding proteins (G proteins), primarily activating the cAMP-dependent pathway . The structural complexity of CALCR allows it to interact with multiple ligands and receptor-activity-modifying proteins, resulting in diverse physiological responses. Research has demonstrated that the extracellular domain plays a critical role in determining ligand specificity and binding affinity.

Which ligands activate CALCR and how does their binding selectivity differ?

CALCR is activated by multiple peptide ligands including calcitonin (CT/CALCA), amylin (IAPP), and calcitonin gene-related peptide type 1 (CGRP1/CALCA), each producing distinct physiological responses . Salmon calcitonin (sCT) has been shown to have particularly high affinity for CALCR across species barriers . These peptides interact with CALCR through specific binding motifs, with the TN(T/V)G sequence near the C-terminus being particularly important for receptor recognition . Research has demonstrated that the C-terminal proline residue in salmon calcitonin is crucial for receptor binding, whereas the C-terminal tyrosine in amylin and amylin analogs has comparatively less influence on binding affinity .

The binding selectivity of these ligands is further modulated by receptor-activity-modifying proteins (RAMPs), which form heterodimeric complexes with CALCR to create pharmacologically distinct receptor phenotypes with altered ligand preferences . Different CALCR-RAMP complexes exhibit unique pharmacological profiles; for instance, CALCR alone preferentially binds calcitonin, while CALCR-RAMP1 (AMY₁ receptor) and CALCR-RAMP2 (AMY₂ receptor) complexes show enhanced affinity for amylin and CGRP . Interestingly, peptide mutagenesis experiments have revealed that ligand binding causes distinct conformational changes in CALCR, leading to specific signaling outcomes and downstream phenotypic effects .

How does CALCR expression and function vary across different tissues?

CALCR is expressed in a diverse range of tissues, each associated with specific physiological functions. In kidneys, the central and peripheral nervous system, skeletal muscle stem cells, and osteoclasts, CALCR plays critical roles in tissue-specific processes . Within bone tissue, CALCR expression on osteoclasts is integral to the regulation of calcium homeostasis and bone resorption, making it a key therapeutic target for bone disorders . The receptor's presence in the nervous system suggests neurological functions that extend beyond calcium regulation, potentially including neuroprotection and pain modulation.

Recent research has uncovered unexpected CALCR expression patterns in various tissues, expanding our understanding of its physiological roles. Immunohistochemical analysis using specific antibodies has demonstrated CALCR expression in rat thymus tissue, while showing negative staining in rat cardiac muscle, highlighting the tissue-specific nature of CALCR distribution . This differential expression pattern is physiologically significant, as it allows targeted calcitonin signaling in specific tissues. Western blot analysis has identified CALCR in rat testis cell lysates, with molecular weights of approximately 70 and 50 kDa, potentially representing different isoforms or post-translationally modified variants of the receptor .

How do RAMPs alter CALCR pharmacology and ligand selectivity?

RAMPs (Receptor Activity-Modifying Proteins) fundamentally transform CALCR pharmacology by forming heterodimeric complexes that create distinct receptor phenotypes with altered ligand preferences . There are three RAMP subtypes (RAMP1, RAMP2, and RAMP3) that can interact with CALCR to form AMY₁, AMY₂, and AMY₃ receptors, respectively . These RAMP-CALCR complexes exhibit markedly different pharmacological profiles compared to CALCR alone, particularly in their responses to amylin, calcitonin, and calcitonin gene-related peptide (CGRP) . For instance, when CALCR associates with RAMP1 or RAMP2, the resulting receptor complexes show significantly enhanced binding affinity for amylin and CGRP compared to CALCR alone .

Research utilizing purified CALCR extracellular domain (ECD) and tethered RAMP1-CALCR and RAMP2-CALCR ECD fusion proteins has demonstrated that tethering RAMPs to CALCR enhances binding of rat amylin (rAmy), CGRP, and the amylin antagonist AC413 . This RAMP-mediated enhancement of peptide binding represents a fundamental mechanism for increasing the diversity of CALCR signaling outcomes. Interestingly, the mechanism by which RAMPs alter CALCR pharmacology appears to differ from how they modulate the related calcitonin receptor-like receptor (CLR), suggesting evolved differences in RAMP function between these receptors . This differential RAMP action adds another layer of complexity to understanding CALCR pharmacology and presents opportunities for targeted therapeutic design.

What molecular mechanisms underlie RAMP-mediated alteration of CALCR function?

The molecular mechanisms by which RAMPs modify CALCR function appear to differ from those observed with the related calcitonin receptor-like receptor (CLR) . While studies of CLR have shown that RAMP1 Trp-84 and RAMP2 Glu-101 make direct contacts with bound peptides to influence selectivity, research suggests a different mechanism may operate with CALCR . Experiments with mutant RAMP1 W84A- and RAMP2 E101A-CALCR ECD complexes showed these mutants retained binding to amylin analogs, indicating that these specific RAMP residues are not critical for peptide binding to CALCR-RAMP complexes, unlike in CLR-RAMP complexes .

The evidence points toward an allosteric mechanism where RAMPs modify the conformation of CALCR rather than directly contacting bound peptides. This hypothesis is supported by experiments showing that swapping the C-terminal residues between different peptide ligands affects binding affinity but does not fully exchange their selectivity profiles for different receptor complexes . These findings suggest that RAMPs induce subtle conformational changes in CALCR that alter its binding pocket and downstream signaling cascades. Further research using techniques such as cryo-electron microscopy and molecular dynamics simulations could provide deeper insights into these allosteric mechanisms. Understanding these molecular details is crucial for the rational design of therapeutics targeting specific CALCR-RAMP complexes with improved selectivity profiles.

How can researchers experimentally distinguish between different CALCR-RAMP complexes?

Distinguishing between different CALCR-RAMP complexes requires a combination of pharmacological, biochemical, and molecular biology approaches. One effective strategy involves using selective peptide antagonists that display differential affinity for various CALCR-RAMP complexes . For example, the amylin antagonist AC413 shows enhanced binding to RAMP-associated CALCR compared to CALCR alone, making it a useful tool for identifying RAMP-CALCR complexes . Researchers can conduct competitive binding assays using radiolabeled ligands with known selectivity profiles to quantitatively assess the proportion of different receptor complexes present in a sample.

Another experimental approach utilizes tethered ECD fusion proteins, where the extracellular domains of CALCR and specific RAMPs are covalently linked . These fusion proteins recapitulate the pharmacological properties of intact receptor complexes and provide a simplified system for studying ligand binding characteristics. Antibodies specifically recognizing epitopes formed by CALCR-RAMP interfaces can also be valuable tools for detecting and quantifying particular receptor complexes. Cell-based assays measuring second messenger responses (such as cAMP accumulation) to selective agonists provide functional readouts that can distinguish between receptor complexes based on their distinct signaling profiles. Advanced techniques like FRET (Fluorescence Resonance Energy Transfer) or BRET (Bioluminescence Resonance Energy Transfer) can monitor CALCR-RAMP interactions in real-time in living cells, offering insights into complex formation dynamics and stability.

What are the primary physiological functions of CALCR in calcium homeostasis and bone metabolism?

CALCR plays a critical role in regulating calcium homeostasis and bone resorption, making it an essential component of skeletal health maintenance . When activated by calcitonin, CALCR on osteoclasts inhibits bone resorption by reducing osteoclast activity and promoting their detachment from bone surfaces. This inhibitory effect on osteoclasts helps maintain bone density and prevents excessive calcium release into the bloodstream. The physiological importance of this mechanism is demonstrated by the clinical efficacy of calcitonin and its analogs in treating hypercalcemia and bone disorders such as osteoporosis and Paget's disease.

Beyond its direct effects on osteoclasts, CALCR signaling influences other bone cells, including osteoblasts and osteocytes, creating a coordinated network for bone remodeling regulation . Research has shown that CALCR deletion in mice leads to increased bone resorption and decreased bone density, confirming its physiological relevance in skeletal homeostasis. In kidneys, CALCR activation decreases calcium excretion and increases phosphate excretion, further contributing to whole-body calcium balance. These diverse physiological effects highlight the central role of CALCR in maintaining calcium homeostasis through coordinated actions across multiple tissues. Understanding these mechanisms has direct clinical implications for developing targeted therapies for metabolic bone diseases.

What emerging evidence suggests CALCR involvement in fetal development and cancer progression?

While CALCR's role in calcium homeostasis is well-established, growing evidence suggests its involvement in fetal morphogenesis and cancer development . During embryonic development, CALCR expression shows distinct temporal and spatial patterns, suggesting developmental roles beyond mineral homeostasis. Studies have identified CALCR expression in fetal tissues undergoing morphogenetic changes, implicating it in tissue patterning, cell migration, and differentiation processes. These findings open new research avenues for understanding CALCR's contribution to normal development and potentially developmental disorders.

In cancer biology, CALCR has been implicated in both tumor-promoting and tumor-suppressing roles, depending on the cancer type and cellular context . Several malignancies, including certain types of lung cancer, breast cancer, and prostate cancer, show altered CALCR expression compared to normal tissues. The receptor may influence cancer progression through multiple mechanisms, including modulation of tumor cell proliferation, apoptosis resistance, angiogenesis, and metastatic potential. Calcitonin/CALCR signaling has been observed to stimulate growth in some cancer cell lines while inhibiting it in others, highlighting the context-dependent nature of this pathway in oncogenesis. These emerging roles in development and cancer present promising targets for future therapeutic interventions and warrant further investigation to fully understand the underlying molecular mechanisms.

What antibody-based techniques are most effective for detecting and studying CALCR in experimental systems?

Several antibody-based techniques have proven effective for detecting and characterizing CALCR in research applications. Western blotting using specific anti-CALCR antibodies allows for the detection of CALCR protein in tissue lysates, revealing both expression levels and molecular weight variants . For example, western blot analysis of rat testis cell lysate using rabbit anti-rat calcitonin receptor antibody at a 1/500 dilution has successfully detected CALCR bands at approximately 70 and 50 kDa, corresponding to different isoforms or post-translationally modified variants . Researchers should optimize protein loading (typically 25-50 μg) and antibody concentration to achieve optimal signal-to-noise ratio.

Immunohistochemistry (IHC) provides valuable information about CALCR's tissue distribution and cellular localization. Rabbit recombinant monoclonal antibodies, such as EPR27455-47, have shown excellent specificity in IHC applications at dilutions of 1/2000 . Proper antigen retrieval is critical for successful IHC with CALCR antibodies; heat-mediated antigen retrieval with Tris-EDTA buffer (pH 9.0) for 20 minutes has proven effective . For immunofluorescence studies, antibody selection should be based on compatibility with the desired detection system. Alternative techniques like flow cytometry can quantify CALCR expression in cell populations, while immunoprecipitation can isolate CALCR complexes for interaction studies. When selecting antibodies, researchers should prioritize those validated against both positive and negative control tissues, with documented specificity for the species of interest and appropriate applications.

How can peptide mutagenesis be effectively used to investigate CALCR-ligand interactions?

Peptide mutagenesis represents a powerful approach for dissecting the molecular details of CALCR-ligand interactions and has yielded significant insights into binding determinants . Alanine-scanning mutagenesis, where individual amino acids are systematically replaced with alanine, has revealed that the TN(T/V)G motif near the C-terminus of both salmon calcitonin and amylin analogs is critical for receptor binding . This approach allows researchers to identify key residues that contribute to binding affinity and selectivity. For optimal results, researchers should generate a comprehensive panel of single-site mutants covering the entire peptide sequence, with particular attention to conserved regions and residues predicted to be at the binding interface.

Complementary to alanine scanning, residue swap experiments between related peptides can provide insights into selectivity determinants. Research has shown that swapping the C-terminal proline of salmon calcitonin with the C-terminal tyrosine of amylin (and vice versa) revealed that these residues contribute significantly to binding affinity but have less impact on receptor selectivity than previously thought . When conducting peptide mutagenesis studies, researchers should employ both binding assays (such as competitive radioligand binding) and functional assays (measuring cAMP production or other signaling outputs) to comprehensively characterize the effects of mutations. Additionally, the use of purified receptor extracellular domains in conjunction with intact cellular receptors can provide complementary insights, as demonstrated by studies with tethered RAMP-CALCR ECD fusion proteins . Computational modeling of receptor-peptide complexes can guide mutagenesis strategies and help interpret experimental results in structural context.

What recombinant expression systems are optimal for producing functional CALCR proteins?

The selection of an appropriate expression system is crucial for producing functional recombinant CALCR for structural and functional studies. Mammalian expression systems, particularly HEK293 and CHO cells, have been successfully used to express functional CALCR and CALCR-RAMP complexes that retain native pharmacological properties . These systems provide proper post-translational modifications and cellular machinery for correct folding and trafficking of CALCR. For optimal expression, researchers should use codon-optimized CALCR sequences and consider adding affinity tags (such as His6 or FLAG) for purification purposes, positioned to minimize interference with ligand binding or RAMP association.

For structural studies requiring larger protein quantities, insect cell systems (Sf9, Sf21, or High Five) using baculovirus vectors offer a good compromise between mammalian-like processing capabilities and higher protein yield. When expressing CALCR-RAMP complexes, co-expression strategies or tethered fusion constructs can ensure proper complex formation . For the production of CALCR extracellular domain (ECD) for binding studies, secreted expression in mammalian or insect cells with appropriate signal peptides has proven effective. Purification strategies typically employ affinity chromatography followed by size exclusion chromatography to ensure homogeneity. Functional validation of purified CALCR should include ligand binding assays and, for membrane-embedded receptors, reconstitution in lipid nanodiscs or detergent micelles with verification of G protein coupling capabilities. Monitoring receptor glycosylation and other post-translational modifications is essential as these can significantly impact receptor function and ligand binding properties.

How do allosteric modulators influence CALCR signaling bias and functional selectivity?

Allosteric modulators represent an exciting frontier in CALCR research, offering potential for fine-tuned regulation of receptor function and signaling bias. Unlike orthosteric ligands that bind to the primary binding site, allosteric modulators bind to distinct sites and can modify receptor conformation, ligand affinity, and signaling pathway selection . Research suggests that RAMPs may function as natural allosteric modulators of CALCR, inducing conformational changes that enhance binding of certain ligands while affecting downstream signaling outcomes . This allosteric mechanism differs from the direct peptide contact model observed with the related receptor CLR, highlighting the diverse regulatory strategies evolved for these receptors.

The concept of signaling bias, where different ligands preferentially activate specific downstream pathways, is particularly relevant for CALCR research. Different CALCR-RAMP complexes have been shown to couple preferentially to distinct G protein subtypes and signaling cascades, resulting in varied cellular responses . For example, while all CALCR complexes activate the cAMP pathway, they do so with different efficacies and may simultaneously engage alternative pathways like calcium mobilization or β-arrestin recruitment to varying degrees. These biased signaling profiles offer opportunities for developing selective CALCR modulators that could activate therapeutic pathways while minimizing unwanted effects. Future research directions include identifying small molecule allosteric modulators specific for distinct CALCR-RAMP complexes and developing biased ligands that selectively activate beneficial signaling pathways for specific therapeutic applications.

What computational approaches are most valuable for modeling CALCR structure and predicting ligand interactions?

Computational modeling approaches have become increasingly valuable for understanding CALCR structure and predicting ligand interactions, especially given the challenges in obtaining experimental structures for membrane proteins . Homology modeling, using the structures of related class B GPCRs as templates, provides initial structural insights into CALCR. Recent advances in AlphaFold and RoseTTAFold have significantly improved the accuracy of predicted protein structures, making them valuable tools for CALCR structural studies. These models can be refined using molecular dynamics simulations to explore conformational flexibility and identify potential ligand binding pockets.

Docking simulations can predict how peptide ligands interact with CALCR models, generating testable hypotheses about key binding residues. Research combining computational modeling with experimental peptide mutagenesis has successfully identified the shared non-helical CGRP-like conformation for the TN(T/V)G motif in salmon calcitonin and amylin antagonists prior to their C-terminus . For modeling CALCR-RAMP complexes, protein-protein docking algorithms can predict interaction interfaces, while molecular dynamics simulations can reveal how these interactions alter CALCR conformation and binding properties. Machine learning approaches are increasingly being applied to predict ligand binding affinities and selectivity profiles based on structural and chemical features. Integration of computational methods with experimental validation creates a powerful approach for understanding CALCR structure-function relationships and designing selective ligands. As computational resources and algorithms continue to improve, these in silico approaches will play an increasingly important role in CALCR research and drug discovery.

How might CALCR-targeted therapeutics evolve beyond current applications in bone disorders?

The existence of pharmacologically distinct CALCR-RAMP complexes creates opportunities for developing complex-selective therapeutics with improved specificity . Recent advances in understanding the structural basis of CALCR-RAMP interactions and their effects on ligand selectivity provide a foundation for rational drug design. For example, the finding that rAmy(8-37) Y37P exhibited enhanced antagonism of the AMY₁ receptor while retaining selectivity demonstrates the feasibility of designing complex-specific modulators . Beyond peptide-based approaches, small molecule allosteric modulators targeting specific CALCR-RAMP complexes represent a promising future direction. Advanced drug delivery systems, such as bone-targeting nanoparticles carrying CALCR modulators, could enhance therapeutic efficacy while minimizing systemic effects. As our understanding of CALCR biology continues to expand, we can anticipate novel therapeutic applications across endocrine, metabolic, neurological, and oncological disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.