Recombinant Rabbit Calcium-binding mitochondrial carrier protein SCaMC-1 (SLC25A24)

Shipped with Ice Packs
In Stock

Description

Role in Mitochondrial ATP-Pi Transport

SCaMC-1 facilitates ATP-Mg²⁺ uptake in exchange for Pi ions, crucial for mitochondrial energy production . Studies in Saccharomyces cerevisiae (yeast) demonstrate calcium-dependent activation with an S₅₀ of ~30 µM, linking cytosolic calcium signals to mitochondrial ATP transport .

Calcium Sensitivity and Transport Regulation

The N-terminal EF-hand domains enable calcium modulation of transport activity. In cancer cells, SCaMC-1 overexpression desensitizes mitochondria to calcium-induced permeability transition, promoting survival under stress .

Localization and Tissue-Specific Expression

  • Mitochondrial Inner Membrane: Primary localization in most cells .

  • Germinal Granules: SCaMC-1L (a paralog) localizes to chromatoid bodies and inter-mitochondrial cement in male germ cells, suggesting roles in spermatogenesis .

Antibodies for Detection and Analysis

Rabbit-derived antibodies are widely used to study SCaMC-1 expression and localization:

Antibody TypeHostReactivityApplicationsPurification
N-terminal region RabbitHuman, Mouse, RatWestern BlotProtein A Affinity
Middle region RabbitCow, Dog, Human, etc.Western BlotProtein A Purified
Full-length MouseHumanFLISA, Western BlotProtein A Affinity

Key Notes:

  • Rabbit antibodies show broad cross-reactivity but may lack specificity for certain isoforms .

  • Western blot remains the primary application, though FLISA compatibility is noted for some clones .

Research Implications and Future Directions

  • Cancer Biology: SCaMC-1 inhibition may sensitize cancer cells to apoptosis by disrupting ATP-Mg transport .

  • Spermatogenesis: SCaMC-1L’s unique localization in germinal granules suggests roles in mitochondrial dynamics during gamete formation .

  • Structural Studies: Recombinant proteins enable detailed analysis of calcium-binding motifs and transmembrane interactions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare according to your specifications.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
SLC25A24; EFINAL; SCAMC1; Calcium-binding mitochondrial carrier protein SCaMC-1; Peroxisomal Ca(2+-dependent solute carrier; Small calcium-binding mitochondrial carrier protein 1; Solute carrier family 25 member 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-475
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
SLC25A24
Target Protein Sequence
MLRWLRGFVLPTAACQGAEPPTRYETLFQALDRNGDGVVDIRELQEGLKSLGIPLGQDAE EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGL TISEQQAELILQSIDADGTMTVDWNEWRDYFLFNPVADIEEIIRFWKHSTGIDIGDSLTI PDEFTEEERKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKVMMQVHGSKSMNIFGGFRQMI KEGGVRSLWRGNGTNVIKIAPETAVKFWVYEQYKKLLTEEGQKIGTFERFISGSMAGATA QTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKYEGFGAFYKGYVPNLLGIIPYAGIDL AVYELLKSHWLDNFAKDSVNPGVLVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGA PQLNMVGLFRRIISKEGLPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier. Facilitates the reversible, electroneutral exchange of Mg-ATP or Mg-ADP against phosphate ions, catalyzing the net uptake or efflux of adenine nucleotides across the mitochondrial inner membrane. Nucleotide transport is inactive at low cytosolic calcium levels and is activated by increased cytosolic calcium concentrations. This protein potentially plays a role in protecting cells against oxidative stress-induced cell death, possibly by promoting the formation of calcium-phosphate precipitates in the mitochondrial matrix, thus buffering calcium levels within the mitochondrial matrix.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Peroxisome. Note=According to PubMed:9238007, it is mainly found in peroxisomes while low levels are present in mitochondrion. The relevance of such results remain unclear in vivo.
Tissue Specificity
Mainly expressed in colon. Also expressed in the small intestine proximal to the ileum. Weakly expressed in kidney but not in the liver.

Q&A

Basic Research Questions

  • What is SCaMC-1 (SLC25A24) and what is its primary function in mitochondria?

    SCaMC-1 (SLC25A24) is a member of the short calcium-binding mitochondrial carrier (SCaMC) subfamily of mitochondrial carriers. It functions as a carboxyatractyloside-resistant ATP-Mg carrier that mediates the transport of ATP-Mg2+/Pi2- and/or ADP2-/Pi2- across the inner mitochondrial membrane . The protein contains calcium-binding motifs (EF-hand domains) facing the intermembrane space, which allow regulation of transport activity by cytosolic calcium without requiring calcium entry into the mitochondria . This provides a novel mechanism for transducing calcium signals to mitochondria. SCaMC-1 is activated by calcium with an S0.5 of approximately 30 μM, resulting in a 2-fold stimulation of ATP transport activity .

  • What is the structure of SCaMC-1 and how does it differ from other mitochondrial carriers?

    SCaMC-1 has a characteristic structure consisting of:

    • N-terminal extension (approximately 200 amino acids) containing four EF-hand calcium-binding motifs with high similarity to calmodulin

    • C-terminal mitochondrial carrier domain (~300 amino acids)

    Unlike typical mitochondrial carriers, SCaMC-1 belongs to the subfamily of calcium-binding mitochondrial carriers (CaMCs). What distinguishes SCaMC-1 from other mitochondrial carriers is the presence of the N-terminal calcium-binding domain that faces the intermembrane space, allowing it to respond to changes in cytosolic calcium without requiring calcium entry into the mitochondrial matrix . This is distinct from the ADP/ATP translocases (AACs), which are sensitive to carboxyatractyloside inhibition, whereas SCaMC-1 is carboxyatractyloside-resistant .

  • How is the transport activity of SCaMC-1 regulated by calcium?

    SCaMC-1 transport activity is regulated by calcium through the following mechanism:

    • The EF-hand motifs in the N-terminal domain bind calcium ions from the cytosolic side

    • Calcium binding induces a conformational change that activates the carrier function of the C-terminal domain

    • The half-maximal activation (S0.5) occurs at approximately 30 μM calcium

    • At maximal calcium concentrations, ATP transport activity is stimulated approximately 2-fold

    This calcium-dependent regulation allows SCaMC-1 to respond to cytosolic calcium signals and adjust mitochondrial ATP content accordingly. The calcium-binding occurs on the external face of the inner mitochondrial membrane, providing a mechanism for calcium signaling without requiring calcium uptake into the mitochondrial matrix .

Experimental Methodology

  • What are the recommended protocols for measuring SCaMC-1-mediated ATP transport in isolated mitochondria?

    For measuring SCaMC-1-mediated ATP transport in isolated mitochondria, the following protocol is recommended based on established research methodologies :

    Materials needed:

    • Isolated mitochondria from tissue or cultured cells

    • [2,5',8-3H]ATP (radioactive ATP for tracking)

    • Calcium buffers (for controlling free calcium concentration)

    • Calcium Green 5N or similar calcium indicator

    Protocol:

    1. Prepare mitochondria in a suitable buffer (e.g., 0.6 M mannitol, 10 mM Tris/maleate, 5 mM MgCl2, 0.2% BSA, pH 6.8)

    2. Add calcium or EGTA to obtain the desired free calcium concentrations

    3. Calibrate free calcium concentrations fluorimetrically using Calcium Green 5N

    4. Initiate transport by adding 4 mM [2,5',8-3H]ATP

    5. Incubate at 30°C with mild orbital shaking

    6. Stop the reaction at defined time points by adding ice-cold buffer

    7. Collect mitochondria by centrifugation at 14000 g for 5 minutes

    8. Measure ATP uptake by scintillation counting of the mitochondrial pellet

    The calcium dependence can be analyzed by varying the free calcium concentration and calculating the S0.5 value using appropriate curve-fitting software. To specifically attribute transport to SCaMC-1, compare results with mitochondria from SCaMC-1 knockout models or after SCaMC-1 knockdown .

  • How can researchers generate and validate SCaMC-1 knockdown models for functional studies?

    To generate and validate SCaMC-1 knockdown models for functional studies, researchers can follow this systematic approach:

    Generation of knockdown models:

    1. siRNA or shRNA approach:

      • Design siRNA/shRNA sequences targeting conserved regions of SCaMC-1 mRNA

      • Transfect cells with siRNA or viral vectors expressing shRNA

      • Establish stable cell lines using appropriate selection markers

    2. CRISPR/Cas9 approach:

      • Design guide RNAs targeting exons of the SCaMC-1 gene

      • Transfect cells with CRISPR/Cas9 components

      • Screen and isolate clones with disrupted SCaMC-1 expression

    Validation methods:

    1. Protein expression verification:

      • Western blotting with specific anti-SCaMC-1 antibodies to confirm reduced protein levels (target reduction to ≤30% of control)

      • Immunofluorescence microscopy to assess subcellular localization

    2. Functional validation:

      • Measure Ca2+-dependent ATP transport in isolated mitochondria

      • Assess mitochondrial calcium retention capacity using calcium-sensitive dyes

      • Evaluate sensitivity to oxidative stress and mitochondrial permeability transition

    3. Rescue experiments:

      • Re-express SCaMC-1 in knockdown cells to confirm specificity of observed phenotypes

      • Use SCaMC-1 mutants lacking calcium-binding domains to assess the role of calcium regulation

    This approach has been successfully used to demonstrate that SCaMC-1 knockdown results in increased sensitivity to oxidative stress-induced cell death, reduced mitochondrial calcium retention capacity, and enhanced mitochondrial permeability transition .

  • What techniques are available for studying calcium-dependent regulation of SCaMC-1 in intact cells?

    Several techniques can be employed to study calcium-dependent regulation of SCaMC-1 in intact cells:

    1. Live-cell imaging of mitochondrial ATP levels:

      • Transfect cells with mitochondrially-targeted ATP biosensors (e.g., ATeam)

      • Monitor ATP levels in response to calcium mobilizing stimuli

      • Compare responses in control versus SCaMC-1 knockdown cells

    2. Mitochondrial calcium retention capacity (CRC) measurement:

      • Load cells with calcium-sensitive fluorescent dyes (e.g., Rhod-2, Calcium Green)

      • Apply calcium mobilizing stimuli or calcium ionophores

      • Quantify mitochondrial calcium uptake and retention capacity

      • Compare CRC between control and SCaMC-1-deficient cells

    3. Real-time monitoring of mitochondrial membrane potential:

      • Use potential-sensitive dyes (e.g., TMRM, JC-1)

      • Monitor changes in response to calcium challenges

      • Assess the protective effect of SCaMC-1 against calcium-induced membrane depolarization

    4. Assessment of mitochondrial permeability transition:

      • Monitor mitochondrial swelling in response to calcium challenges

      • Use calcein-cobalt quenching assay to detect mPTP opening

      • Compare sensitivity to mPTP induction between control and SCaMC-1-deficient cells

    These approaches have revealed that SCaMC-1 plays a crucial role in desensitizing mitochondria to calcium-induced permeability transition by mediating ATP-Mg/Pi uptake, thereby enhancing matrix calcium buffering capacity .

Advanced Research Questions

  • How does SCaMC-1 contribute to the regulation of mitochondrial permeability transition and cell survival in cancer cells?

    SCaMC-1 plays a critical role in regulating mitochondrial permeability transition (mPT) and promoting cancer cell survival through several mechanisms:

    1. Enhanced mitochondrial calcium buffering:

      • SCaMC-1 mediates calcium-activated ATP-Mg2+/Pi2- uptake into mitochondria

      • Increased matrix ATP enhances calcium phosphate precipitation in the matrix

      • This increases the calcium retention capacity (CRC) of mitochondria

      • Higher CRC desensitizes mitochondria to calcium-induced mPT

    2. Protection against oxidative stress:

      • SCaMC-1 knockdown renders cells more susceptible to H2O2 or menadione-induced cell death

      • This protection is specific to mPT-dependent necrotic cell death, as SCaMC-1 knockdown does not affect staurosporine-induced apoptosis

    3. Negative feedback control between calcium overload and cell death:

      • Cytosolic calcium overload activates SCaMC-1

      • Activated SCaMC-1 increases mitochondrial ATP, enhancing calcium buffering

      • This creates a negative feedback loop that protects against calcium-mediated mPT

      • In cancer cells with upregulated SCaMC-1, this feedback mechanism is enhanced

    Experimental evidence shows that SCaMC-1 overexpression is a general feature of transformed and cancer cells. Re-expression of SCaMC-1 in knockdown cells, as well as its overexpression in cells with low endogenous levels, renders cells more resistant to H2O2- or C2-ceramide-induced cell death . This suggests SCaMC-1 might be a potential target for cancer therapy by sensitizing cancer cells to oxidative stress-induced death.

  • What is the evolutionary significance of SCaMC proteins and how do the different paralogs differ in function and expression?

    The evolutionary analysis of SCaMC proteins reveals significant insights into their specialized functions:

    Evolutionary conservation and diversification:

    • SCaMC proteins form a complex and highly conserved subfamily of mitochondrial carriers in eukaryotes

    • In mammals, there are four main SCaMC paralogs (SCaMC-1, -2, -3, and -3L) plus the mammalian-specific SCaMC-1Like

    • These paralogs likely arose through gene duplication events, with SCaMC-1 and SCaMC-1Like existing in a tandem array suggestive of a recent duplication

    Functional specialization of paralogs:

    ParalogPrimary ExpressionFunctional CharacteristicsRegulatory Features
    SCaMC-1Widely expressed, upregulated in cancer cellsATP-Mg/Pi carrier, protective against mPTCa2+ activation (S0.5 ~30 μM)
    SCaMC-2Multiple splice variants with tissue specificityATP-Mg/Pi carrierVariable Ca2+ sensitivity due to splicing
    SCaMC-3Brain and other tissuesATP-Mg/Pi carrierCa2+ regulated transport
    SCaMC-1LikeRestricted to male germ cellsAtypical localization in germ cellsHigher amino acid substitution rate than SCaMC-1

    SCaMC-1Like: A unique evolutionary innovation:

    • SCaMC-1Like shows mammalian-specific expression restricted to male germ cells

    • Unlike other SCaMC proteins, SCaMC-1Like displays both mitochondrial and non-mitochondrial localization

    • In spermatocytes, it localizes to inter-mitochondrial cement, and in round spermatids to the chromatoid body

    • This suggests a specialized role in spermatogenesis beyond typical mitochondrial functions

    The evolutionary diversification of SCaMC proteins indicates tissue-specific adaptations of mitochondrial calcium signaling and adenine nucleotide homeostasis across different cellular contexts, highlighting the importance of these processes in cell physiology.

  • How do SCaMC-1 and other calcium-binding mitochondrial carriers differ from the classical mitochondrial calcium uniporter pathway in calcium signaling?

    SCaMC-1 and other calcium-binding mitochondrial carriers (CaMCs) represent a distinct mechanism of calcium signaling compared to the classical mitochondrial calcium uniporter (MCU) pathway:

    Classical MCU pathway:

    • Involves direct calcium uptake into the mitochondrial matrix

    • Calcium enters through the mitochondrial calcium uniporter complex

    • Activates calcium-sensitive matrix dehydrogenases (pyruvate, α-ketoglutarate, isocitrate dehydrogenases)

    • Typically responds to high calcium microdomains (>10 μM) near ER-mitochondria contact sites

    • Directly increases matrix calcium concentration

    SCaMC-1 and CaMC pathway:

    • Does not require calcium entry into mitochondria

    • Calcium binds to EF-hand motifs on the external face of the inner membrane

    • Activates transport of metabolites (ATP-Mg/Pi for SCaMC-1, aspartate/glutamate for AGCs)

    • Responds to global cytosolic calcium signals (S0.5 ~30 μM for SCaMC-1)

    • Indirectly affects mitochondrial function through metabolite content changes

    Evolutionary considerations:

    • Some organisms lack MCU but retain CaMCs (e.g., Saccharomyces cerevisiae has Sal1p but no MCU)

    • This suggests CaMCs may represent an evolutionarily ancient mechanism of calcium signaling

    • In higher eukaryotes, both systems coexist and likely cooperate

    Functional integration:

    • MCU-mediated calcium uptake can trigger mitochondrial permeability transition

    • SCaMC-1-mediated ATP-Mg uptake enhances matrix calcium buffering

    • This creates a regulatory circuit where SCaMC-1 protects against excessive MCU-mediated calcium accumulation

    This dual system allows for multiple modes of calcium signaling to mitochondria with different sensitivity ranges and functional outcomes, providing complex regulatory control over mitochondrial metabolism and cell survival.

  • What are the potential therapeutic implications of targeting SCaMC-1 in cancer and other diseases?

    Targeting SCaMC-1 holds significant therapeutic potential across several disease contexts:

    Cancer therapy:

    • SCaMC-1 is overexpressed in numerous cancer cell lines and transformed cells

    • Knockdown sensitizes cancer cells to oxidative stress-induced death via mPT

    • Could synergize with chemotherapies that increase oxidative stress or cytosolic calcium

    • Potential for selective targeting of cancer cells that rely on SCaMC-1 for survival

    Potential approaches for SCaMC-1 inhibition:

    1. Small molecule inhibitors of the carrier function

    2. Compounds that interfere with calcium binding to the EF-hands

    3. Antisense oligonucleotides or siRNAs for SCaMC-1 knockdown

    4. Peptide inhibitors mimicking key regions of SCaMC-1

    Soft-tissue calcification disorders:

    • SCaMC-1 has been identified as elevated in calcifying matrix vesicles

    • It was found to be 3.2-fold higher in matrix vesicles from human coronary artery smooth muscle cells cultured in osteogenic media

    • May represent a target for treating pathological soft-tissue calcification

    Ischemia-reperfusion injury:

    • SCaMC-1 may protect against ischemia-reperfusion damage by enhancing mitochondrial calcium buffering

    • The ATP-Mg/Pi carrier function has been implicated in recovery of mitochondrial adenine nucleotide content after hypoxia or ischemia

    • Activators of SCaMC-1 might be protective in contexts where mPT-dependent cell death contributes to tissue damage

    Precision medicine considerations:

    • Efficacy of SCaMC-1-targeted therapies likely depends on:

      • Expression levels of SCaMC-1 vs. other paralogs

      • Calcium signaling patterns in target cells

      • Relative contribution of mPT to disease pathophysiology

    These therapeutic approaches remain largely theoretical and require further research to validate SCaMC-1 as a drug target, develop specific inhibitors, and establish appropriate biomarkers for patient selection.

Technical Considerations for Recombinant Protein Applications

  • What are the optimal conditions for using recombinant rabbit SCaMC-1 in reconstitution experiments?

    For successful reconstitution experiments with recombinant rabbit SCaMC-1, researchers should consider these technical parameters:

    Protein preparation and storage:

    • Purified recombinant SCaMC-1 should be stored in a buffer containing 50mM Tris-Glycine, pH 7.4, with 0.15M NaCl, 50% Glycerol

    • Addition of 0.05% BSA helps stabilize the protein

    • Recommended storage: short-term at 4°C; long-term at -20°C in aliquots to avoid freeze-thaw cycles

    Reconstitution protocol for proteoliposomes:

    1. Prepare liposomes using a mixture of phosphatidylcholine and phosphatidylethanolamine (9:1 ratio)

    2. Destabilize preformed liposomes with detergent (e.g., Triton X-100)

    3. Add purified SCaMC-1 at a protein:lipid ratio of 1:100 to 1:50

    4. Remove detergent using Bio-Beads or similar adsorbents

    5. Isolate proteoliposomes by ultracentrifugation

    Critical parameters for transport assays:

    • Internal buffer: 10 mM PIPES, 50 mM NaCl, pH 7.0

    • External buffer: 10 mM PIPES, 50 mM NaCl, 0.5 mM EGTA or varying Ca2+ concentrations, pH 7.0

    • Temperature: 25-30°C

    • ATP-Mg concentration: 0.1-5 mM range

    • Time course: Initial rates measured within 0-2 minutes

    Calcium dependence measurements:

    • Prepare calcium buffers using EGTA-calcium mixtures

    • Verify free calcium concentrations using calcium-sensitive dyes

    • Test concentration range: 0-100 μM free calcium

    • Control experiments should include calcium ionophores to equilibrate calcium across proteoliposome membranes

    These conditions have been successfully used to demonstrate that SCaMC-1 functions as a calcium-regulated ATP-Mg/Pi carrier, with transport activity increasing approximately 2-fold at saturating calcium concentrations .

  • How can researchers distinguish between SCaMC-1-mediated ATP transport and that mediated by other mitochondrial carriers in experimental systems?

    Distinguishing SCaMC-1-mediated ATP transport from other carriers requires specific experimental strategies:

    Pharmacological approaches:

    InhibitorSCaMC-1ADP/ATP TranslocaseComment
    Carboxyatractyloside (CAT)ResistantSensitiveUse 5-10 μM CAT to inhibit AAC while preserving SCaMC-1 activity
    Bongkrekic acidResistantSensitiveAlternative AAC inhibitor
    Calcium chelation (EGTA)InhibitedUnaffectedSCaMC-1 requires calcium for activation

    Genetic approaches:

    1. Gene knockout/knockdown:

      • Compare ATP transport in mitochondria from wild-type vs. SCaMC-1 knockout/knockdown cells

      • SCaMC-1 disruption reduces ATP uptake by approximately 50%

      • Combine with CAT to isolate SCaMC-1-specific component

    2. Double knockout models:

      • Create models lacking both ADP/ATP translocase and SCaMC-1

      • Particularly informative in yeast systems using Sal1p (yeast SCaMC ortholog) and AAC knockouts

    Biochemical approaches:

    1. Transport kinetics:

      • SCaMC-1 shows distinct kinetic parameters compared to AAC

      • Characteristic calcium dependence with S0.5 of ~30 μM

      • Examine transport under varying Pi concentrations, as SCaMC-1 catalyzes ATP-Mg/Pi exchange

    2. Substrate specificity:

      • Test transport of ATP vs. ADP vs. other nucleotides

      • SCaMC-1 primarily transports ATP-Mg rather than free ATP

    3. Reconstitution experiments:

      • Purify recombinant SCaMC-1 and reconstitute in proteoliposomes

      • Allows direct measurement of SCaMC-1 activity in isolation from other carriers

    By combining these approaches, researchers can reliably distinguish the contribution of SCaMC-1 to mitochondrial ATP transport from that of other carriers, particularly the ubiquitous ADP/ATP translocase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.