Recombinant Rabbit Complement component C9 (C9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
C9; Complement component C9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-557
Protein Length
Full Length of Mature Protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
C9
Target Protein Sequence
GPTPSYVHEPIQRSDPLQPIDCRMSPWSEWSHCDPCLRQMFRSRSIEVFGQFHGKSCVDA LGDRRACIPTEACEDAEEDCEKDEFHCGTGRCIKRRLLCNGDNDCGDFSDEDDCETEPRL TCRNREVQESELARTAGYGINILGMDPLATPFDNEYYHGLCDRVWDGNTLTHYRKPWNVA VLAYETKIDKNFRTEYYEEQMQAFKSIIEEETSNFNANLALKFTPTEAKASKAEEASPKN KSLDDNDKGFSSKFQFSYSKNETYQLFLSYSSQKEKMFLLVKGIIQLGRFVMKNRGVMLT NTFLDDIKSLPTTYEKGEYFAFLETYGTHYSSSGSLGGRYELIYVLDKASMKEKGIELND IKKCLGFDLDLSLNIPGKSAGLSLTGQANKNNCLKSGHGNAVNITRANLIDDVISLIRGG TQKFAFELKEKLLTKAKMVDVTDFINWASSLSDAPVLINQKLSPIYNLIPVKIKDAHQKR QNLERGIEDYINEFSTKKCSPCQNGGTALLMDGQCLCTCPFMFEGIACEISKRKLA
Uniprot No.

Target Background

Function

Recombinant Rabbit Complement component C9 (C9) is a constituent of the membrane attack complex (MAC), playing a crucial role in both innate and adaptive immune responses. Its function is to form pores in the plasma membranes of target cells, acting as the pore-forming subunit of the MAC.

Database Links
Protein Families
Complement C6/C7/C8/C9 family
Subcellular Location
Secreted. Target cell membrane; Multi-pass membrane protein.

Q&A

What is Complement Component C9 and what is its role in the complement system?

Complement Component C9 represents the final component incorporated into the membrane attack complex (MAC) of the complement system. It completes the sequence of events leading to target membrane destruction. After binding to the membrane-bound C5b-8 complex, C9 molecules unfold and bind with each other to form a cylindrical structure that becomes inserted into the target membrane . While C9 significantly enhances the rate of hemolysis, some evidence indicates that lysis of erythrocytes can occur even without C9, though at a much slower rate .

The MAC may contain a variable number (nine or more) of C9 molecules, unlike components C5b-8 which occur only once in each individual MAC. Additionally, C9 monomers can polymerize independently to form tubular poly-C9 structures . C9 participates in critical functions including hemolysis, bacteriolysis, and lipopolysaccharide (LPS) release .

What are the structural characteristics of recombinant rabbit C9?

Recombinant rabbit C9 (from Oryctolagus cuniculus) produced through prokaryotic expression in E. coli systems typically has the following characteristics:

PropertySpecification
SourceProkaryotic expression
HostE. coli
Predicted Molecular Mass46.9 kDa
Accurate Molecular Mass47 kDa
ResiduesPro139~Lys519 with N-terminal His Tag
Buffer FormulationPBS, pH 7.4, containing 0.01% SKL, 5% Trehalose
Isoelectric Point8.7
Purity> 80%

The protein is typically available in freeze-dried powder form for research applications .

How does recombinant C9 differ from native C9 in functional studies?

Unglycosylated recombinant C9 demonstrates several differences from native C9:

  • Hemolytic activity: Unglycosylated recombinant C9 maintains approximately 10% of the hemolytic activity exhibited by native C9 .

  • Polymerization tendency: Unglycosylated C9 polymerizes more readily than the native protein .

  • Structural variants: Removal of the first 23 amino acids or mutation of two cysteines at positions 33 and 36 further increases spontaneous polymerization .

These differences should be carefully considered when designing experiments that compare the functional properties of recombinant versus native C9 in complement-mediated activities.

What are the optimal methods for producing recombinant rabbit C9?

In vitro synthesis of recombinant C9 can be accomplished through several established methods:

  • PCR-based approach:

    • Use one or two-step polymerase chain reaction (PCR) to add the T7 RNA polymerase promoter

    • Simultaneously introduce desired mutations within the cDNA

    • Transcribe the cDNA using T7 RNA polymerase

    • Translate the resulting mRNA in either rabbit reticulocyte lysate or wheat germ systems

  • Verification of successful synthesis:

    • Confirm correct size of PCR product DNA by agarose gel electrophoresis

    • Verify incorporation of [alpha-32P]UTP into mRNA

    • Validate formation of [35S]methionine-labeled protein with correct molecular mass for full-length C9

  • Production yield considerations:

    • Wheat germ extract systems can generate up to 1.5 micrograms of recombinant C9

    • For higher yields, prokaryotic expression in E. coli with appropriate purification tags is often employed

This approach allows for rapid screening of multiple mutations and their effects on biological activity and polymerization of C9 .

What are the optimal storage conditions for maintaining recombinant C9 stability?

To maintain the stability and functional integrity of recombinant C9, the following storage protocols are recommended:

  • Short-term storage (up to one month):

    • Store at 2-8°C

    • Avoid repeated freeze/thaw cycles

  • Long-term storage (up to 12 months):

    • Aliquot the protein solution

    • Store at -80°C

  • Reconstitution protocol:

    • Reconstitute in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL

    • Do not vortex to avoid protein denaturation

The thermal stability of recombinant C9 can be assessed by an accelerated thermal degradation test. When incubated at 37°C for 48h, properly stored C9 should show no obvious degradation or precipitation, with a loss rate of less than 5% within the expiration date under appropriate storage conditions .

How can the functional activity of recombinant C9 be assessed?

Several methodological approaches exist for evaluating the functional activity of recombinant C9:

  • Hemolytic assays:

    • Using antibody-sensitized sheep red blood cells (SRBCs) or human red blood cells (HRBCs)

    • Measuring complement-dependent hemolysis in a dose-dependent manner

    • Comparing hemolytic activity between wild-type and modified C9 proteins

  • In vivo hemolysis assessment:

    • Injection of anti-mouse RBC polyclonal antibodies (anti-MRBC) to evaluate antibody-activated complement hemolysis

    • Measurement of hemolysis levels at specific time points (e.g., 20 minutes post-injection)

  • MAC formation analysis:

    • Assessment of C9 polymerization and MAC assembly using electron microscopy

    • Evaluation of transmembrane channel formation

    • Analysis of C9 to C8 ratios in determining the size of channels formed by C5b-9

These methods provide comprehensive assessment of both the structural integrity and functional capacity of recombinant C9 in research applications.

How does C9 contribute to the structural dynamics of the membrane attack complex?

C9 plays a crucial role in determining the final structure and functionality of the MAC:

  • Membrane penetration:

    • C9 subunits penetrate the hydrocarbon core of the lipid bilayer more deeply than any other subunit of the MAC

    • MAC-associated C9 extends from the hydrophilic phase into the hydrocarbon phase of the membrane

  • Channel formation dynamics:

    • The C9 to C8 ratio appears to determine the size of transmembrane channels formed by C5b-9

    • Multiple C9 molecules (typically nine or more) bind to C5b-8 in forming the functional MAC

  • Structural organization:

    • C9 mediates the fusion of two C5b-8 complexes to form the characteristic ring structure of the dimeric MAC

    • Both C5b-9 dimerization and C9-mediated hemolysis are temperature-sensitive reactions

    • The dimeric nature of the MAC has been supported by molecular weight studies and molecular hybridization experiments

Research examining the ultrastructural characteristics has demonstrated that formation of the ring-like membrane lesion caused by complement is entirely dependent on C9, highlighting its essential role in MAC architecture and function .

What are the implications of C9 deficiency in immune response studies?

Research on C9-deficient models provides valuable insights into the specific contributions of C9 to immune responses:

  • Protection against inflammatory conditions:

    • C9 deficiency significantly protects mice against lipopolysaccharide (LPS)-induced shock

    • C9 deficiency leads to decreased MAC formation

  • Complement-dependent hemolysis:

    • Complete loss of complement activity in mediating antibody-activated hemolysis in C9-deficient models

    • Wild-type and heterozygous models show dose-dependent hemolytic effects, with heterozygous models showing intermediate activity

  • Rate-limiting effects:

    • C9 demonstrates a rate-limiting or dependent effect for MAC formation

    • This is evidenced by the higher hemolytic effect of wild-type serum compared to heterozygous serum

These findings suggest that while C9 is not absolutely required for all MAC functions, it significantly enhances MAC efficiency and plays a critical role in certain immune responses, particularly those involving rapid membrane lysis .

How do specific mutations in recombinant C9 affect its polymerization and function?

Strategic mutations in recombinant C9 can dramatically alter its properties:

  • N-terminal modifications:

    • Removal of the first 23 amino acids increases spontaneous polymerization

    • This suggests the N-terminal region plays a regulatory role in controlling C9 assembly

  • Cysteine mutations:

    • Mutating two cysteines at positions 33 and 36 increases spontaneous polymerization

    • These residues appear to be critical for maintaining C9 in its monomeric form until appropriate activation

  • Structure-function relationships:

    • Despite having only 10% of native hemolytic activity, unglycosylated recombinant C9 maintains core functional capabilities

    • The increased polymerization tendency of recombinant C9 suggests glycosylation may play a regulatory role in preventing premature assembly

These findings provide researchers with valuable tools for investigating the molecular mechanisms underlying C9 polymerization and MAC formation, which are central to complement-mediated cytolysis .

What are common challenges when working with recombinant C9 and how can they be addressed?

Several technical challenges may arise when working with recombinant C9:

  • Protein stability issues:

    • Challenge: Loss of activity due to improper storage or handling

    • Solution: Store at 2-8°C for short-term use (up to one month); for long-term storage, aliquot and store at -80°C; avoid repeated freeze/thaw cycles

  • Low hemolytic activity:

    • Challenge: Unglycosylated recombinant C9 exhibits approximately 10% of the hemolytic activity of native C9

    • Solution: Increase protein concentration accordingly when designing functional assays; consider using native C9 as a positive control for activity comparison

  • Premature polymerization:

    • Challenge: Recombinant C9 polymerizes more readily than native C9

    • Solution: Store in appropriate buffer conditions; consider using polymerization inhibitors if studying monomeric C9; perform experiments promptly after reconstitution

  • Species-specificity considerations:

    • Challenge: Potential cross-reactivity or differences in complement activation between species

    • Solution: Use species-matched components when possible; validate cross-species activity before experimental design

How should researchers design experiments to compare native and recombinant C9 functions?

When comparing native and recombinant C9 functions, consider the following experimental design principles:

  • Activity normalization:

    • Adjust protein concentrations to account for the approximately 10% hemolytic activity of unglycosylated recombinant C9 compared to native C9

    • Consider activity-based rather than concentration-based comparisons

  • Polymerization assessment:

    • Include assays to measure polymerization rates between native and recombinant C9

    • Control for the increased spontaneous polymerization of recombinant C9

  • Temperature considerations:

    • Account for the temperature sensitivity of C9-mediated hemolysis

    • Maintain consistent temperature conditions across experimental comparisons

  • Controls and validations:

    • Include heat-inactivated serum controls to confirm complement dependency

    • Use C9-deficient models or antibody-depleted systems as negative controls

    • Perform parallel assays with both recombinant and native C9 under identical conditions

A systematic approach comparing multiple parameters will provide the most comprehensive understanding of the functional similarities and differences between native and recombinant C9.

What experimental protocols best demonstrate the role of C9 in MAC formation and function?

To effectively investigate C9's role in MAC formation and function, consider these methodological approaches:

  • Hemolytic assays:

    • Protocol: Use antibody-sensitized erythrocytes (sheep, human, or mouse) with varying concentrations of C9

    • Analysis: Measure hemolysis rates and extent at different time points

    • Controls: Include C9-deficient serum and heat-inactivated serum

  • Structural analysis:

    • Protocol: Electron microscopy of MAC formation with and without C9

    • Analysis: Examine ring structure formation and membrane insertion

    • Variants: Compare wild-type C9 with mutant forms (e.g., cysteine mutations at positions 33 and 36)

  • In vivo complement activation:

    • Protocol: Administer anti-erythrocyte antibodies to wild-type and C9-deficient models

    • Analysis: Measure hemolysis levels at defined time points post-injection

    • Variables: Test different antibody doses to determine concentration-dependent effects

  • MAC polymerization dynamics:

    • Protocol: Monitor C9 polymerization rates under varying conditions (temperature, pH, ionic strength)

    • Analysis: Assess the impact of C9:C8 ratios on channel size and lytic efficiency

    • Applications: Evaluate how structural modifications affect polymerization kinetics

These experimental approaches provide complementary data to elucidate the multifaceted roles of C9 in MAC assembly, structure, and function.

What are emerging applications of recombinant C9 in immunological research?

Several innovative research directions are emerging for recombinant C9 applications:

  • Therapeutic targeting of complement pathways:

    • Development of C9 inhibitors to modulate MAC formation in inflammatory conditions

    • Investigation of C9-specific antibodies or small molecules that can selectively block MAC assembly without affecting earlier complement functions

  • Structural biology advances:

    • Cryo-electron microscopy studies of MAC assembly with modified recombinant C9 variants

    • Investigation of the precise mechanisms of C9 polymerization and channel formation

  • Disease model applications:

    • Using C9-deficient models to investigate the role of MAC in various inflammatory and autoimmune conditions

    • Exploring the potential protective effects of C9 deficiency against certain pathologies

  • Biotechnology applications:

    • Engineering C9-based pore-forming proteins for targeted cell lysis

    • Development of MAC-inspired nanopores for biotechnological applications

These emerging applications demonstrate the continuing importance of recombinant C9 research beyond its classical role in complement studies.

How might comparative studies between species-specific C9 proteins advance our understanding of complement evolution?

Comparative studies of C9 from different species offer unique insights into complement system evolution:

  • Structure-function conservation:

    • Analysis of conserved domains versus variable regions across species

    • Correlation between structural variations and functional differences in MAC formation and lytic efficiency

    • Identification of species-specific regulatory mechanisms

  • Evolutionary adaptations:

    • Investigation of how different pathogen pressures may have shaped C9 evolution across species

    • Examination of C9 polymorphisms and their potential correlation with resistance to specific diseases

    • Understanding the evolutionary relationship between C9 and other pore-forming proteins

  • Cross-species compatibility:

    • Evaluation of functional interchange between C9 proteins from different species

    • Assessment of species barriers in MAC formation and function

    • Insights into the minimal conserved structures required for MAC assembly

These comparative approaches can provide deeper understanding of both basic complement biology and potential therapeutic strategies based on evolutionary insights.

How can researchers integrate structural, functional, and genetic approaches in C9 studies?

An integrated research approach to C9 studies combines multiple perspectives:

  • Structure-guided mutagenesis:

    • Using structural information to design specific mutations in recombinant C9

    • Evaluating how these mutations affect polymerization, MAC assembly, and lytic function

    • Correlating structural changes with functional outcomes

  • Genomics-proteomics integration:

    • Analysis of C9 gene variants and their correlation with protein structure/function

    • Investigation of post-translational modifications (especially glycosylation) on C9 function

    • Comparison between recombinant and native C9 to understand the impact of these modifications

  • Systems biology perspective:

    • Examination of C9's interactions within the broader complement network

    • Investigation of regulatory mechanisms controlling C9 expression and activation

    • Modeling of MAC assembly dynamics under various physiological conditions

This integrative approach provides a comprehensive understanding of C9 biology that spans from molecular mechanisms to systemic functions, offering more robust insights than any single methodology alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.