Recombinant Rabbit CX3C chemokine receptor 1 (CX3CR1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2134989
Source
in vitro E.coli expression system
Synonyms
CX3CR1; CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; Fractalkine receptor
Quick Inquiry

Description

Production and Purification

The recombinant protein is synthesized via cloning the rabbit CX3CR1 gene into bacterial vectors, followed by affinity chromatography purification. This method ensures high yield and consistency, critical for structural studies and assay standardization .

Advantages of Recombinant Production:

  • Animal origin-free: Avoids ethical concerns and batch variability .

  • Enhanced immunoreactivity: Rabbit-derived antibodies exhibit broader target recognition due to a larger immune repertoire .

Functional Roles and Research Applications

Recombinant CX3CR1 is widely used to study:

  • Immune cell trafficking: Mediates adhesion and migration of monocytes, NK cells, and microglia via fractalkine binding .

  • Viral pathogenesis: Acts as a co-receptor for HIV-1/HIV-2 and respiratory syncytial virus (RSV), facilitating viral entry .

  • Inflammatory diseases: Linked to atherosclerosis, age-related macular degeneration, and autoimmune disorders .

Key Research Findings:

  • RSV Infection: CX3CR1 expression in cotton rat lungs correlates with RSV titers; knockdown reduces viral load by 10-fold .

  • HIV Interaction: Fractalkine binding inhibits HIV-1 envelope fusion, suggesting therapeutic potential .

  • Neuroinflammation: CX3CR1 signaling regulates microglial activation in spinal cord injury models .

Research Limitations and Future Directions

While recombinant CX3CR1 enables mechanistic studies, its bacterial expression lacks post-translational modifications (e.g., glycosylation), potentially altering ligand-binding kinetics . Future work may employ mammalian or insect cell systems to address this. Additionally, its role in CX3CL1-independent pathways (e.g., angiogenesis modulation) remains underexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
CX3CR1; CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; Fractalkine receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
CX3CR1
Target Protein Sequence
MTTLYSDWATESFEYDESSEACFIGDIVAFGTIFLSIFYSLVFAFGLVGNLLVVCALTSS RKPKSITDIYLLNLALSDLLFVATLPFWTHYVISEQGFHNAVCKLTTALFFIGFFGGIFF ITVISIDRYMAIVLAANSINNRTVQHGVTTSLGVWAAAILVAAPQFMFTKQKGNECLGDY PEVLQDIWPVLRNTEANFLGFLLPVLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIV FFLFWTPYNVMIFLETLKLYGFFPNCDMKRDLRLALSVTETVAFSHCCLNPLIYAFAGQK FRRYLRHLSRKCQAVLCGRPVHVSFSPSESQRSRQESIVSSNFTHYTSDGDASLLL
Uniprot No.
Q2KTE1

Target Background

Function
CX3CR1, the receptor for the C-X3-C chemokine fractalkine (CX3CL1), is expressed on various early leukocyte cells. CX3CR1-CX3CL1 signaling plays distinct roles in different tissue compartments, including immune response, inflammation, cell adhesion, and chemotaxis. This signaling pathway mediates cell migratory functions, contributing to the recruitment of natural killer (NK) cells to inflamed tissues. It acts as a regulator in the inflammatory process leading to atherogenesis, mediating macrophage and monocyte recruitment to inflamed atherosclerotic plaques and promoting cell survival. In airway inflammation, it promotes interleukin 2-producing T helper (Th2) cell survival in inflamed lungs. CX3CR1-CX3CL1 signaling is involved in the migration of circulating monocytes to non-inflamed tissues, where they differentiate into macrophages and dendritic cells. It acts as a negative regulator of angiogenesis, possibly by promoting macrophage chemotaxis. This receptor plays a crucial role in brain microglia by regulating inflammatory responses in the central nervous system (CNS) and regulating synapse maturation. Its presence restrains microglial inflammatory responses in the CNS, preventing parenchymal damage in response to pathological stimuli. CX3CR1 is involved in brain development by participating in synaptic pruning, a natural process where brain microglia eliminate extra synapses during postnatal development. Microglial synaptic pruning is essential for promoting the maturation of circuit connectivity during brain development. CX3CR1 is a critical regulator of the gut microbiota, controlling immunity to intestinal bacteria and fungi. It is expressed in lamina propria dendritic cells in the small intestine, which form transepithelial dendrites capable of taking up bacteria, providing defense against pathogenic bacteria. CX3CR1 is required to initiate innate and adaptive immune responses against the dissemination of commensal fungi (mycobiota) in the gut. It is expressed in mononuclear phagocytes (MNPs) and promotes the induction of antifungal IgG antibody responses, conferring protection against disseminated C. albicans or C. auris infections. CX3CR1 also acts as a receptor for C-C motif chemokine CCL26, inducing cell chemotaxis.
Database Links

KEGG: ocu:100008874

STRING: 9986.ENSOCUP00000024608

UniGene: Ocu.5753

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.