Recombinant Rabbit Cyclic nucleotide-gated olfactory channel (CNGA2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Role

CNGA2 is the α-subunit of a heterotetrameric cyclic nucleotide-gated (CNG) channel complex. Key features include:

  • Domains: Six transmembrane helices (S1–S6), a pore-forming region, and a cytoplasmic cyclic nucleotide-binding domain (CNBD) .

  • Function: Binds cAMP/cGMP to open cation-permeable channels, initiating depolarization in olfactory neurons. Calcium influx through CNGA2 further activates calcium-dependent chloride channels (e.g., Bestrophin-2) to amplify signals .

  • Species-Specific Sequence: The rabbit CNGA2 (UniProt ID: Q28718) shares homology with human and mouse isoforms but contains unique residues critical for leucine zipper-mediated tetramerization .

Recombinant Production and Characterization

Recombinant rabbit CNGA2 is typically expressed in E. coli with affinity tags for purification. Key parameters include:

ParameterDetails
Expression SystemE. coli (e.g., BL21 strains)
TagN-terminal 10×His tag for nickel-affinity chromatography
Purity>90% (verified by SDS-PAGE)
StorageLyophilized at -20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile water or glycerol-containing buffers to prevent aggregation

Electrophysiological Studies

  • Channel Activation: Recombinant CNGA2 forms homomeric channels in heterologous systems, enabling patch-clamp studies of cAMP/cGMP-dependent gating .

  • Calcium-Calmodulin Regulation: Used to investigate Ca²⁺-mediated feedback inhibition, a mechanism critical for olfactory adaptation .

Key Findings from Peer-Reviewed Studies

  • Olfactory Amplification: CNGA2-mediated Ca²⁺ influx activates Bestrophin-2 chloride channels, amplifying depolarization by 50–100% in olfactory cilia .

  • Subunit Cooperativity: Co-expression with CNGB1b subunits shifts cAMP/cGMP sensitivity, mimicking native heteromeric channel behavior .

  • Disease Models: Mutations in CNGA2 homologs are linked to congenital anosmia in mice, highlighting its role in sensory signaling .

Limitations and Future Directions

  • Lack of Post-Translational Modifications: E. coli-expressed CNGA2 lacks mammalian glycosylation, potentially altering channel kinetics .

  • Heteromeric Assembly: Current systems struggle to replicate native α/β subunit stoichiometry, necessitating advanced co-expression platforms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please indicate it during your order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributors for precise delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To ensure optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please communicate your preference, and we will prioritize developing the specified tag.
Synonyms
CNGA2; CNCG2; Cyclic nucleotide-gated olfactory channel; Aorta CNG channel; RACNG; Cyclic nucleotide-gated cation channel 2; Cyclic nucleotide-gated channel alpha-2; CNG channel alpha-2; CNG-2; CNG2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-664
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MTEKSNGVKSSPANNHNNHVPATIKANGKDESRTRSRPQSAADDDTSSELQRLAEMDAPQ QRRGGFRRIVRLVGVIRQWANRNFREEEARPDSFLERFRGPELQTVTTQQGDGKGDKDGD GKGTKKKFELFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQRGYFLVWLVLDY FSDVVYIADLFIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGI HNPELRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSI GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIKWFDYLWTNK KTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDY ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVAASMEVDVQEK LKQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLEVKMKQNTEDDYLSDGMNSPEPAA AEQP
Uniprot No.

Target Background

Function
Odorant signal transduction is likely mediated by a G-protein coupled cascade utilizing cAMP as a second messenger. The olfactory channel can be shown to be activated by cyclic nucleotides, leading to the depolarization of olfactory sensory neurons.
Database Links
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is CNGA2 and what is its role in olfactory signal transduction?

CNGA2 is the pore-forming subunit of the olfactory cyclic nucleotide-gated channel. It operates in the cilia of olfactory sensory neurons where chemical stimulation by odorants is converted to an electrical signal. The channel mediates odorant-induced cyclic adenosine monophosphate (cAMP)-dependent calcium influx, which triggers neuron depolarization. The resulting rise in intracellular calcium levels serves dual functions: it potentiates the olfactory response by activating calcium-dependent chloride channels, while simultaneously providing negative feedback to desensitize the channel for rapid adaptation to odorants. CNGA2 is essential for conducting both cAMP- and cyclic guanosine monophosphate (cGMP)-gated ion currents, with permeability for both monovalent and divalent cations .

What is the composition of native olfactory CNG channels?

Native olfactory CNG channels exist as heterotetramers composed of two CNGA2 subunits, one CNGA4 subunit, and one CNGB1b subunit. Among these subunits, only CNGA2 can independently form functional homotetrameric channels. While homotetrameric CNGA2 channels provide useful experimental models, their properties differ from native heteromeric channels. For instance, CNGA2/CNG4.3 heteromeric channels display significantly increased sensitivity for cAMP compared to homotetrameric CNGA2 channels, while their cGMP affinity remains unchanged. Additionally, CNG4.3 weakens outward rectification in the presence of extracellular calcium, decreases relative calcium permeability, and enhances sensitivity to l-cis diltiazem .

How can researchers distinguish between different CNG channel subunits?

Researchers can distinguish between different CNG channel subunits using several complementary approaches:

What is the significance of hysteresis in CNGA2 channel gating?

Hysteresis in CNGA2 channel gating represents a fundamental biophysical property with significant functional implications. Using fluorescent cGMP derivative (fcGMP), researchers have demonstrated that ligand unbinding from homotetrameric CNGA2 channels is approximately 50 times faster at saturating concentrations than at subsaturating levels. This phenomenon occurs because the fully liganded channel reaches a distinct open state from which it can rapidly unbind all four ligands, whereas partially liganded open channels can only unbind ligands from closed states .

This concentration-dependent gating mechanism creates two distinct pathways:

  • Activation pathway: Ligand binding and channel activation follow one transition sequence

  • Deactivation pathway: Ligand unbinding and channel deactivation follow a different sequence

The resulting hysteresis allows CNGA2 channels to respond to changes in cyclic nucleotide concentration with different kinetics depending on the concentration range. This property is particularly important in olfactory neurons, enabling rapid adaptation following strong stimulation while maintaining sensitivity to subtle concentration changes in low-stimulus environments .

How do different subunit compositions affect CNGA2 channel function?

Different subunit compositions dramatically alter the functional properties of CNG channels containing CNGA2:

Subunit CompositioncAMP SensitivitycGMP SensitivityCa²⁺ PermeabilityOutward RectificationL-cis Diltiazem Sensitivity
CNGA2 homomersLowerBaselineHigherStrongerLower
CNGA2/CNG4.3IncreasedUnchangedDecreasedWeakenedEnhanced
CNGA2/CNG5Moderately increasedUnchangedModifiedModifiedModified
CNGA2/CNG4.3/CNG5Highest (near native)ModifiedClosest to nativeClosest to nativeClosest to native

These compositional differences are physiologically significant because cAMP is the natural second messenger in olfaction. The heteromeric CNGA2/CNG5 channel shows increased affinity for cAMP compared to CNGA2 homomers, but still exhibits approximately threefold lower affinity than native channels. This discrepancy can be resolved by incorporating CNG4.3, as CNGA2/CNG4.3/CNG5 heteromers closely reproduce native channel properties .

What are the current models explaining CNGA2 activation mechanisms?

Current models of CNGA2 activation incorporate several key findings about channel gating:

  • Multi-ligand binding model: Analysis of steady-state concentration-activation relationships consistently produces Hill coefficients of approximately 2, indicating that at least two ligands are required for full channel activation. Single-channel studies have confirmed this minimum requirement .

  • Cooperative binding mechanism: Global fit analysis of activation time courses suggests that at least three ligands are involved in channel activation, with binding showing positive cooperativity .

  • Distinct binding and unbinding pathways: Complex Markovian models reveal that ligand unbinding follows different pathways depending on the level of channel occupancy. Partially liganded channels unbind ligands from closed states only, while fully liganded channels reach a different open state that permits rapid unbinding of all four ligands .

  • Subunit-dependent modulation: Beta subunits like CNG4.3 modulate channel properties by altering cyclic nucleotide sensitivity, ion selectivity, and gating kinetics .

These models have significant implications for understanding how olfactory neurons encode both the identity and concentration of odorants, as well as how they adapt to continuous stimulation.

What techniques are most effective for studying CNGA2 channel function?

Several complementary techniques provide valuable insights into CNGA2 function:

  • Electrophysiology: Patch-clamp recordings in inside-out membrane patches allow direct measurement of channel activity in response to different cyclic nucleotide concentrations. This approach can determine concentration-response relationships, ion selectivity, and gating kinetics .

  • Fluorescent ligand binding assays: Using fluorescent cyclic nucleotide derivatives (e.g., fcGMP) enables researchers to directly observe ligand binding and unbinding kinetics in real-time .

  • Heterologous expression systems: Human embryonic kidney 293 cells provide a reliable platform for expressing recombinant CNGA2 channels, either as homomers or in combination with other subunits. This approach allows systematic investigation of how different subunit compositions affect channel properties .

  • CRISPR/Cas9 genome editing: Generation of knockout models helps validate antibody specificity and elucidate the physiological roles of different channel subunits. Both premature stop codon mutants and large in-frame deletions targeting functional domains can be employed .

  • Markovian modeling: Complex Markovian models incorporating multiple open and closed states can explain the concentration-dependent kinetics and hysteresis observed in CNGA2 channels .

How should antibodies against CNGA2 be validated?

Thorough validation of antibodies against CNGA2 is critical due to potential cross-reactivity. A comprehensive validation approach should include:

  • Heterologous expression validation: Confirm antibody specificity by testing against recombinant CNGA2 expressed in cell culture systems like HEK293 cells. Western blot and immunocytochemistry should show specific labeling only in transfected cells .

  • Genetic validation: Generate CRISPR/Cas9-mediated knockout models and verify complete loss of antibody immunoreactivity. This step is essential, as genome editing studies have revealed unexpected discrepancies between in vitro and in vivo antibody reactivity .

  • Multiple antibody comparison: Use multiple antibodies targeting different epitopes of CNGA2 to confirm consistent localization patterns.

  • Absorption controls: Pre-incubate antibodies with purified antigen to demonstrate specific blocking of immunoreactivity.

  • Cross-species validation: Confirm consistent labeling patterns across species with high sequence homology in the targeted epitope.

Researchers should be particularly cautious with antibody interpretations, as demonstrated by a notable case where anti-CNGA2a monoclonal antibody showed unexpected immunoreactivity that was only eliminated by knocking out oxytocin (OXT) despite the lack of sequence similarities between OXT and CNGA2a proteins .

How can researchers interpret concentration-response relationships for CNGA2?

Interpreting concentration-response relationships for CNGA2 requires consideration of several factors:

  • Hill coefficient analysis: CNGA2 channels consistently produce Hill coefficients of approximately 2, indicating that at least two ligands must bind for full channel activation. This cooperative binding is a fundamental property that should be reflected in concentration-response curves .

  • Subunit composition effects: When comparing different experimental conditions or between studies, researchers must account for subunit composition. Heteromeric channels containing CNG4.3 show significantly increased sensitivity to cAMP compared to CNGA2 homomers, while cGMP affinity remains largely unchanged .

  • Hysteresis considerations: Traditional steady-state concentration-response curves may not fully capture the dynamic properties of CNGA2 channels due to hysteresis. Separate analyses of opening and closing transitions can reveal important differences in concentration-dependent kinetics .

  • Native context comparison: Data from heterologous expression systems should be compared with native channel properties. The threefold difference in cAMP affinity between heterologously expressed CNGA2/CNG5 channels and native olfactory channels highlights the importance of additional factors like CNG4.3 in determining physiological responses .

What are the key considerations for designing CNGA2 knockout experiments?

Designing effective CNGA2 knockout experiments requires careful planning:

  • Targeting strategy: CRISPR/Cas9 genome editing allows creation of different mutation types. Researchers can generate premature stop codons (e.g., 2bp indel creating early termination) or large in-frame deletions targeting specific functional domains (e.g., cyclic nucleotide-binding domain) .

  • Paralog compensation: Consider potential compensation by paralogous genes. For CNGA2, experimental designs should account for possible functional redundancy among channel subunits .

  • Validation methods: Implement multiple validation approaches, including sequencing, protein expression analysis, and functional studies. Unexpected findings, such as persistent antibody reactivity despite confirmed genetic deletion, should prompt careful investigation rather than being dismissed .

  • Subunit-specific phenotypes: When analyzing phenotypes, consider the specific role of individual subunits. For example, CNGA2 is essential for forming functional homotetrameric channels, while CNG4.3 modifies channel properties but cannot form functional channels independently .

  • Tissue-specific effects: Use tissue-specific knockout approaches when appropriate, particularly given the widespread expression of some CNG channel subunits across different sensory systems .

What are the emerging areas of CNGA2 research?

Several promising research directions are emerging in the CNGA2 field:

  • Structural biology: Advanced cryo-electron microscopy techniques can reveal the detailed molecular structure of CNGA2 in different conformational states, providing insights into gating mechanisms and subunit interactions.

  • Single-molecule approaches: Real-time observation of individual channel molecules can elucidate stochastic aspects of CNGA2 function that are masked in population measurements.

  • Computational modeling: Advanced Markovian models and molecular dynamics simulations can integrate experimental findings into comprehensive frameworks explaining complex phenomena like hysteresis .

  • In vivo imaging: Genetically encoded calcium or voltage indicators can visualize CNGA2 activity in intact olfactory neurons, providing insights into channel function within native cellular contexts.

  • Therapeutic applications: Understanding CNGA2 function may inform development of treatments for olfactory disorders or development of biosensors for environmental monitoring.

How do different CNG4 isoforms influence sensory transduction across systems?

The finding that distinct CNG4 isoforms assemble with both photoreceptor and olfactory α subunits to form functional channels suggests a general role for CNG4 subunits across different sensory transduction pathways. This presents several important research questions:

  • Isoform-specific functions: Different CNG4 isoforms (like CNG4.1 in photoreceptors and CNG4.3 in olfactory neurons) appear to be specialized for particular sensory systems. The unique 74 amino acid N-terminal sequence in CNG4.3 and its lack of the glutamic acid-rich domain found in photoreceptor CNG4.1 likely confer system-specific properties .

  • Evolutionary conservation: The conservation of CNG4 functions across different sensory modalities suggests fundamental roles in sensory signal transduction that have been maintained through evolution.

  • Differential modulation: Different CNG4 isoforms may provide tissue-specific regulation of channel properties, allowing customization of response characteristics for particular sensory requirements .

  • Heterogeneity of sensory responses: The variable expression of different β subunits could explain the heterogeneity of CNG channel properties observed in individual olfactory neurons, potentially contributing to the diversity of olfactory response profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.