Recombinant Rabbit Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rabbit Cytochrome c Oxidase Subunit 2 (MT-CO2)

Recombinant Rabbit Cytochrome c Oxidase Subunit 2 (MT-CO2) is a vital component of the cytochrome c oxidase complex, also known as Complex IV, which resides within the mitochondrial electron transport chain . This enzyme complex is essential for oxidative phosphorylation, the primary mechanism by which cells generate ATP (adenosine triphosphate), the energy currency of the cell . MT-CO2 facilitates the transfer of electrons from cytochrome c to oxygen, contributing to the creation of an electrochemical gradient that drives ATP synthesis .

Gene and Protein Information

The MT-CO2 gene encodes for the cytochrome c oxidase subunit 2 protein . The human MT-CO2 gene is also known under the aliases HGNC: 7421, NCBI Gene: 4513, Ensembl: ENSG00000198712, and UniProtKB/Swiss-Prot: P00403 . It is located in the mitochondrial inner membrane and is a part of respiratory chain complex IV .

Function and Role in Cellular Respiration

MT-CO2 plays a crucial role in the electron transport chain . The respiratory chain contains three multisubunit complexes: succinate dehydrogenase (complex II), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, or complex III), and cytochrome c oxidase (complex IV) . These complexes work together to transfer electrons from NADH and succinate to molecular oxygen . This process establishes an electrochemical gradient across the inner mitochondrial membrane, which powers ATP synthase . Cytochrome c oxidase, containing MT-CO2, catalyzes the reduction of oxygen to water, using electrons from cytochrome c and protons from the mitochondrial matrix .

Interactions and Functional Partners

MT-CO2 interacts with several other proteins to perform its function within the cytochrome c oxidase complex . Key interacting proteins include:

  • COX6A1: Cytochrome c oxidase subunit 6A1, mitochondrial

  • COX5B: Cytochrome c oxidase subunit 5B, mitochondrial

  • UQCRC2: Cytochrome b-c1 complex subunit 2, mitochondrial

  • UQCRFS1: Cytochrome b-c1 complex subunit Rieske, mitochondrial

  • COX5A: Cytochrome c oxidase subunit 5A, mitochondrial

  • MT-CO1: Cytochrome c oxidase subunit 1

  • MT-CYB: Cytochrome b

  • MT-ATP6: ATP synthase subunit a

  • MT-ND1: NADH-ubiquinone oxidoreductase chain 1

  • MT-ND5: NADH-ubiquinone oxidoreductase chain 5

These interactions are vital for the proper assembly and function of the electron transport chain and oxidative phosphorylation .

Diseases and Pathways

MT-CO2 is associated with several diseases, including Mitochondrial Complex IV Deficiency and Mitochondrial Complex V Deficiency . It is also related to pathways such as gene expression (transcription) and respiratory electron transport .

Expression

MT-CO2 is expressed in a variety of tissues, including the brain, heart, liver, and kidney . Its presence is crucial for energy production in these and other tissues .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MAYPFQLGFQDASSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLNPGDLRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLISTRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSLSMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation, a process central to cellular energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in concert to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center in subunit 2 and heme A in subunit 1 to the active site (a binuclear center, BNC) in subunit 1, comprising heme A3 and CuB. The BNC utilizes four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Gene References Into Functions
  1. Etodolac, a selective COX-2 inhibitor, significantly inhibited ICl in cell pretreatment studies. PMID: 24084720
  2. Safflower injection may mitigate lung ischemia/reperfusion injury by suppressing cyclooxygenase-2 expression. PMID: 21141516
  3. RNA interference targeting COX-2 effectively inhibited COX-2 and MMP-2 expression in IL-1α-stimulated rabbit corneal stromal cells in vitro. PMID: 19175164
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MT-CO2 in the mitochondrial respiratory chain?

MT-CO2 (also known as COX2, COII) is one of the core subunits of cytochrome c oxidase (Complex IV), which is the terminal enzyme of the mitochondrial electron transport chain. The protein has a molecular mass of approximately 25.6 kDa in humans and consists of 227 amino acids . Structurally, MT-CO2 contains two transmembrane alpha-helices in its N-terminal domain and houses a crucial binuclear copper A center (CuA) located in a conserved cysteine loop at positions 196 and 200, with a conserved histidine at position 204 .

Functionally, MT-CO2 plays a critical role in the electron transport process. It contains the CuA active site that receives electrons from cytochrome c in the intermembrane space. These electrons are subsequently transferred via heme A in subunit 1 to the binuclear center formed by heme A3 and copper B, where molecular oxygen is reduced to water . This process contributes to generating the electrochemical gradient that drives ATP synthesis.

How does MT-CO2 interact with cytochrome c during electron transport?

The electron transfer between cytochrome c and MT-CO2 is remarkably efficient. Kinetic studies have shown that when cytochrome c is bound to cytochrome c oxidase, the half-life for electron transfer from the reducing agent ascorbate to cytochrome c and subsequent transfer to heme a are both less than 5 milliseconds . The second-order rate constant for the oxidation of exogenous ferrocytochrome c by the traditional oxidized complex is approximately 0.55×10^6 M^-1·s^-1, while that for the steady-state complex is about 0.27×10^6 M^-1·s^-1 .

What is the genetic basis of MT-CO2 and how is it conserved across species?

In humans, the MT-CO2 gene is located on the p arm of mitochondrial DNA at position 12 and spans 683 base pairs . MT-CO2 is one of the three mitochondrial DNA-encoded subunits of respiratory complex IV, alongside MT-CO1 and MT-CO3.

Comparative studies have demonstrated high sequence conservation of MT-CO2 across species. For example, in Sitophilus zeamais (maize weevil), the full-length cDNA of the COXII gene contains an open reading frame of 684 bp encoding 227 amino acids, with a molecular mass of 26.2 kDa and a pI value of 6.37 . Multiple sequence alignment and phylogenetic analysis have shown that Sitophilus zeamais COXII has high sequence identity with the COXII of other insect species . This conservation reflects the essential role of this subunit in cellular respiration across diverse taxonomic groups.

What expression systems are most effective for producing recombinant MT-CO2?

For successful expression of recombinant MT-CO2, bacterial expression systems have proven effective. In research with the COXII gene from Sitophilus zeamais, the gene was successfully subcloned into the pET-32a expression vector and expressed in Escherichia coli Transetta (DE3) system after induction with isopropyl β-D-thiogalactopyranoside (IPTG) . The recombinant protein was produced with a 6-His tag, which facilitated purification through affinity chromatography using Ni(2+)-NTA agarose .

The expression yielded a fusion protein of approximately 44 kDa (as confirmed by Western blotting), with a final concentration of about 50 μg/mL . This approach ensures adequate protein yield for subsequent experimental applications. For researchers working with rabbit MT-CO2, a similar expression system could be employed, with appropriate codon optimization for efficient expression in the bacterial host.

What purification strategies yield the highest purity and enzymatic activity for recombinant MT-CO2?

The most effective purification strategy involves a combination of affinity chromatography and additional purification steps to ensure both high purity and preserved enzymatic activity:

  • Affinity Chromatography: Utilizing a 6-His tag and Ni(2+)-NTA agarose affinity chromatography provides an efficient first-step purification .

  • Activity Preservation: During purification, it's crucial to maintain the native conformation of MT-CO2 to preserve its enzymatic activity. Spectroscopic analysis using UV-spectrophotometry and infrared spectrometry can confirm that the purified recombinant MT-CO2 retains its catalytic ability to oxidize cytochrome c substrate .

  • Quality Control: Western blotting should be employed to confirm the identity and integrity of the purified protein, with expected molecular weight for the recombinant rabbit MT-CO2 fusion protein typically being 44-45 kDa .

How can I assess the functional activity of recombinant MT-CO2 in vitro?

Several methods can be employed to evaluate the functional activity of recombinant MT-CO2:

  • Spectrophotometric Assays: UV-spectrophotometry can monitor the oxidation of reduced cytochrome c, which absorbs maximally at 550 nm in the reduced state. The decrease in absorbance at this wavelength indicates the oxidation of cytochrome c by active MT-CO2 .

  • Stopped-Flow Kinetic Analysis: This technique allows for the measurement of rapid electron transfer reactions. For cytochrome c oxidase activity, the half-life for electron transfer from reduced cytochrome c to the enzyme can be determined, with functional MT-CO2 showing half-lives of less than 5 ms .

  • Steady-State Spectral Analysis: A comprehensive spectral analysis between 400-630 nm can confirm electron transfer from reducing agents (e.g., ascorbate) to cytochrome c and subsequently to MT-CO2 .

  • Enzyme Kinetics Determination: The second-order rate constant for the oxidation of exogenous ferrocytochrome c can be calculated. For functional recombinant MT-CO2, this value should be in the range of 0.27-0.55×10^6 M^-1·s^-1 .

How do specific mutations in MT-CO2 affect its interaction with other respiratory chain components?

Mutations in MT-CO2 can significantly alter its interaction with other respiratory chain components, particularly affecting electron transfer efficiency. A well-documented example is the pathogenic m.7887G>A variant, which causes a p.(Gly101Asp) substitution in the MT-CO2 protein . This mutation results in:

  • Impaired Cytochrome c Oxidation: The altered MT-CO2 structure affects the interaction with cytochrome c, reducing electron transfer efficiency.

  • Disrupted Complex IV Assembly: Histochemical analysis of muscle tissue from patients with this mutation shows cytochrome c oxidase (COX) deficiency in a mosaic pattern, indicating compromised assembly or stability of the entire complex IV .

  • Perturbed Respiratory Chain Dynamics: The mutation causes secondary disturbances in fatty acid oxidation pathways, evidenced by abnormal acylcarnitine profiles similar to those seen in multiple acyl-CoA dehydrogenase deficiency (MADD) .

Research examining protein-protein interactions through techniques such as blue native gel electrophoresis, co-immunoprecipitation, or proximity ligation assays can provide detailed insights into how specific mutations alter the interaction landscape of MT-CO2.

What techniques are most effective for studying MT-CO2 variants in relation to mitochondrial disease pathogenesis?

Several sophisticated techniques have proven valuable for investigating MT-CO2 variants in the context of mitochondrial disease:

  • Single Fiber Segregation Studies: This approach involves isolating individual muscle fibers by laser-capture microdissection and analyzing the correlation between COX deficiency and mutant load. COX-deficient fibers typically show higher levels of pathogenic MT-CO2 mutations compared to COX-positive fibers .

  • Quantitative Pyrosequencing: This technique can accurately determine the level of heteroplasmy (the mixture of mutant and wild-type mtDNA) in various tissues and isolated single fibers. Using platforms like PyroMark Q24, researchers can reliably detect heteroplasmy levels >3% .

  • Multi-tissue Analysis: Comparing the distribution and abundance of MT-CO2 variants across different tissues (muscle, urinary sediments, blood, buccal epithelia) provides insights into tissue-specific manifestations of mitochondrial disease .

  • Familial Studies: Analyzing tissues from family members can help establish whether an MT-CO2 variant arose de novo or was maternally inherited, which is crucial for determining pathogenicity .

  • Functional Validation: Biochemical assays measuring complex IV activity in patient-derived tissues or in model systems expressing the variant provide direct evidence of functional consequences.

What is the relationship between MT-CO2 defects and metabolic abnormalities in mitochondrial diseases?

MT-CO2 defects can lead to profound metabolic abnormalities due to compromised oxidative phosphorylation. Research has revealed several key metabolic consequences:

  • Altered Acylcarnitine Profiles: Patients with pathogenic MT-CO2 variants show abnormal acylcarnitine profiles reminiscent of fatty acid oxidation disorders, particularly multiple acyl-CoA dehydrogenase deficiency (MADD) . This includes elevations in medium and long-chain acylcarnitines.

  • Secondary Fatty Acid Oxidation Disturbances: Complex IV deficiency due to MT-CO2 mutations causes perturbation of fatty acid oxidation pathways. Similar metabolic signatures have been observed in other conditions causing isolated complex IV deficiency, such as LRPPRC-related mitochondrial disease .

  • Lactic Acidosis: Impaired electron transport chain function leads to increased reliance on glycolysis for ATP generation, resulting in elevated lactate production.

The table below summarizes the key metabolic abnormalities associated with MT-CO2 defects:

Metabolic ParameterObservation in MT-CO2 DefectsComparable Condition
AcylcarnitinesElevations in C2, C6, C12, C14, C14:1, C16, C18:1, C18:2Multiple acyl-CoA dehydrogenase deficiency (MADD)
LactateElevated in blood and CSFVarious mitochondrial disorders
TCA cycle intermediatesAltered ratiosOther respiratory chain defects
Amino acidsElevated alanineNon-specific marker of mitochondrial dysfunction

How can MT-CO2 variants be differentiated as pathogenic versus benign in clinical research settings?

Establishing the pathogenicity of MT-CO2 variants requires a multifaceted approach:

  • Heteroplasmy Quantification: Pathogenic MT-CO2 variants typically show higher heteroplasmy levels in affected tissues. Quantitative methods such as pyrosequencing can accurately determine heteroplasmy levels across different tissues .

  • Single Fiber Analysis: COX-deficient muscle fibers should show significantly higher mutant loads compared to COX-positive fibers if the variant is truly pathogenic. This segregation pattern is a strong indicator of pathogenicity .

  • De Novo Occurrence vs. Maternal Inheritance: Investigation of maternal relatives' tissues can help establish whether a variant arose de novo, which may support pathogenicity in the context of appropriate clinical features .

  • Conservation Analysis: Pathogenic variants typically affect highly conserved amino acid residues across species. Computational prediction tools and multiple sequence alignments can assess conservation and predict functional impact .

  • Biochemical Confirmation: Direct measurement of complex IV activity in relevant tissues provides functional evidence of pathogenicity. In the case of the m.7887G>A variant, muscle biopsy showed marked COX deficiency in the proband but not in the clinically unaffected mother, supporting its pathogenic nature .

What are the specific clinical manifestations associated with MT-CO2 variants, and how do they correlate with biochemical defects?

MT-CO2 variants can manifest with diverse clinical phenotypes, reflecting the ubiquitous requirement for mitochondrial respiration. The correlation between specific variants and clinical manifestations includes:

  • Cerebellar Ataxia and Neuropathy: The pathogenic m.7887G>A (p.Gly101Asp) variant in MT-CO2 has been associated with progressive cerebellar syndrome and sensory neuropathy with onset in early adulthood .

  • Myopathy: Some MT-CO2 variants cause myopathy with or without recurrent myoglobinuria .

  • Multisystem Disease: Certain variants lead to complex presentations featuring neurodevelopmental delay, gait disorders, cardiac involvement, retinitis pigmentosa, and lactic acidosis .

  • MELAS-like Syndrome: MT-CO2 variants have been reported in patients presenting with mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS) .

The biochemical defects underlying these manifestations include:

What are the emerging techniques for modulating MT-CO2 expression or function in research models?

Several cutting-edge approaches are being developed to modulate MT-CO2 expression or function in research models:

  • Mitochondrially-Targeted Nucleases: Technologies such as mitochondrially-targeted TALENs (mitoTALENs) or zinc finger nucleases can be used to selectively eliminate mutant mtDNA in heteroplasmic models.

  • Base Editing of mtDNA: Recent advances in mitochondrial base editing (using deaminase enzymes fused to mitochondrially-targeted DNA-binding domains) offer potential for direct correction of point mutations in MT-CO2.

  • Allotopic Expression: Nuclear expression of mitochondrially-encoded genes with appropriate targeting sequences can bypass mtDNA mutations. This approach could be applied to MT-CO2 variants for rescue experiments.

  • Small Molecule Modulators: High-throughput screening efforts are identifying compounds that can enhance residual complex IV activity or stabilize partially assembled complexes containing mutant MT-CO2.

  • Induced Pluripotent Stem Cell (iPSC) Models: Patient-derived iPSCs carrying MT-CO2 mutations can be differentiated into relevant cell types (neurons, myocytes, etc.) to study tissue-specific effects and test therapeutic interventions.

How might the interaction between MT-CO2 and potential therapeutic compounds be characterized in experimental settings?

The interaction between MT-CO2 and potential therapeutic compounds can be characterized through a combination of computational and experimental approaches:

  • Molecular Docking: Computational methods can predict binding sites and affinities between MT-CO2 and small molecules. For example, studies with allyl isothiocyanate (AITC) showed that a sulfur atom in the AITC structure could form a 2.9 Å hydrogen bond with Leu-31 of COX II .

  • Spectroscopic Analyses: UV-spectrophotometry and infrared spectrometry can detect changes in MT-CO2 activity in the presence of candidate compounds. These methods have successfully shown that AITC can influence the catalytic function of COX II in oxidizing cytochrome c .

  • Structure-Activity Relationship Studies: Systematic modification of lead compounds combined with activity assays can identify critical moieties required for interaction with MT-CO2.

  • Site-Directed Mutagenesis: Mutating predicted interaction sites in MT-CO2 followed by binding and activity assays can validate computational predictions and provide insights into the mechanism of compound action.

  • Respirometry: Oxygen consumption measurements in isolated mitochondria or cells treated with candidate compounds can assess functional outcomes of MT-CO2 targeting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.