Recombinant Rabbit Dimethylaniline monooxygenase [N-oxide-forming] 4 (FMO4)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant rabbit FMO4 is typically expressed in E. coli systems with a His-tag for purification . Modifications such as truncation of the C-terminal region (Δ26 variants) have improved solubility and reduced aggregation .

Key Production Parameters:

  • Host Systems: E. coli, yeast, baculovirus, mammalian cells

  • Yield: ~13–62% soluble protein in cytosolic fractions under optimized conditions

  • Purity: ≥85% (verified via SDS-PAGE)

Functional Characterization

Recombinant rabbit FMO4 exhibits NADPH-dependent monooxygenase activity, catalyzing S- and N-oxidation of substrates like methionine and dimethylaniline .

SubstrateActivityKm (mM)Diastereoselectivity
MethionineS-oxidation to methionine sulfoxide~0.04–5 Low (d/l ratio: 1.5–2.0)
S-Allyl-l-cysteineS-oxidation>10 Similar to methionine
DimethylanilineN-oxidation to dimethylaniline N-oxideNot reportedHigh

Applications in Research

  • Xenobiotic Metabolism: Studies drug-pesticide interactions and metabolic pathways involving CYP3A4, CYP2D6, and other cytochrome P450 enzymes .

  • Disease Models: Investigated in trimethylaminuria (fish odor syndrome), hepatitis, and Prader-Willi syndrome .

  • Structural Biology: Truncated variants (e.g., Δ26) enable crystallization efforts to resolve FMO4’s 3D structure .

Key Research Findings

  1. Expression Optimization: Relocating the stop codon by 81 base pairs enabled functional expression in E. coli, overcoming translational inefficiencies in full-length FMO4 .

  2. Catalytic Efficiency: Despite low substrate affinity (Km >10 mM for some substrates), FMO4 shows distinct regioselectivity compared to FMO3 .

  3. Thermostability: Retains ~70% activity after mild heat treatment (45°C for 5 minutes), unlike FMO3 .

Challenges and Solutions

  • Aggregation: Native FMO4 forms insoluble aggregates in bacterial systems. Truncation of the C-terminal hydrophobic region (residues 529–555) reduces aggregation by 50% .

  • Low Expression: Codon optimization and His-tag fusion improve yield without altering enzymatic properties .

Comparative Analysis

FeatureRabbit FMO4Human FMO4
Amino Acid Length555 residues 558 residues
Expression SystemE. coli (truncated variants) Not successfully expressed natively
Catalytic ActivityBroad substrate specificity Similar but less characterized

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
FMO4; Dimethylaniline monooxygenase [N-oxide-forming] 4; Dimethylaniline oxidase 4; FMO 1E1; Hepatic flavin-containing monooxygenase 4; FMO 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-555
Protein Length
Full Length of Mature Protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
FMO4
Target Protein Sequence
AKKVAVIGAGVSGLTSIKCCLDEDLEPTCFERSNDIGGLWKYTETSKDGMTRIYWSLVTN VCKEMSCYSDFPFQEDYPNFMSHSKFWNYLQEFAEHFDLLKYIQFKTTVCSVTKRPDFSK TGQWDVVTETEGKQHRAVFDAVMVCTGKFLNPRLPLESFPGILKFRGQILHCQEYKIPEG FRGQRVLVIGLGNSGGDVAVELSRVAAQVLLSTRTGTWVISRSSNGGYPFNMMITRRCLN VIEQVLPSCFLRWINERQMNKRFNHENYGLSITKGKNPKFIVNDELPTCILCGTVTVKTS VKEFTETSAIFEDGTVEENIDSVIFTTGYVFSFPFLEEPLRSLCMKKMFLYKHVFPSNLE RASMAIIGLISLKGSILTGTELQARWATRVFKGLCKIPPPQQLMAEVTKKEELIKRGVIK DTSEEKLSYIPYMDDLAACIGTKPNIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWDG ARNAILTQWDRTLKPLKTRTVSSDSSKSASLSHYLKVWGAPLLLASVLLICKSSHFLKSV RDKLQNRIFPYLVL
Uniprot No.

Target Background

Function
This protein plays a crucial role in the oxidative metabolism of a wide range of xenobiotics, including drugs and pesticides.
Database Links
Protein Families
FMO family
Subcellular Location
Microsome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Kidney and liver.

Q&A

What is Flavin-containing monooxygenase 4 (FMO4) and what distinguishes it from other FMO isoforms?

Flavin-containing monooxygenase 4 (FMO4) is a member of the FMO gene family involved in xenobiotic metabolism. Unlike other FMO isoforms (FMO1, FMO2, FMO3, and FMO5) which contain approximately 531-535 amino acid residues, FMO4 is notably elongated with 558 residues in human and 555 residues in rabbit orthologs . This extended C-terminal coding region represents the most distinctive structural feature of FMO4 and has significant implications for its expression in heterologous systems. FMO4 is functionally involved in the oxidation of various heteroatoms, contributing to the biotransformation of xenobiotics through oxygenation reactions that typically increase their polarity and facilitate elimination .

Why has expression of recombinant FMO4 been challenging for researchers?

Expression of intact FMO4 has been problematic across multiple heterologous systems including Escherichia coli, baculovirus, yeast, and COS systems . Research has demonstrated that the primary challenge stems from a post-transcriptional issue related to the extended C-terminal coding region of FMO4. This elongation, which adds approximately 23-27 amino acids compared to other FMO isoforms, appears to interfere with translation efficiency rather than transcription . The extended C-terminal region creates a translational barrier that prevents efficient production of the functional enzyme, necessitating genetic modifications such as the introduction of an earlier stop codon to achieve successful expression .

What are the tissue expression patterns of FMO4 in normal versus cancerous states?

FMO4 exhibits a unique expression pattern that distinguishes it from other FMO family members in both normal and pathological conditions. In lung adenocarcinoma models, FMO4 shows significantly increased expression in tumor tissues compared to adjacent normal lung tissue with a more than 4-fold increase in tumor samples . Intriguingly, this upregulation pattern is opposite to that observed for FMO1, FMO2, and FMO3, which are typically downregulated in the same tumor contexts . This distinctive expression profile has been consistently observed across multiple genetic mouse models of lung adenocarcinoma driven by different oncogenic drivers (including EGFR and KRAS mutations), suggesting that FMO4 upregulation may be a common feature in lung cancer pathogenesis regardless of the initiating oncogenic event .

What strategies have been successful for expressing functional recombinant FMO4?

The most effective strategy for expressing functional recombinant FMO4 involves genetic modification of the extended C-terminal coding region. Researchers successfully expressed human FMO4 in E. coli by introducing a single base change that created a premature stop codon at the consensus position (comparable to the stop position in other FMO isoforms) . This modification effectively truncated the protein by 27 amino acids, relocating the stop codon 81 bases 5' of its natural position. The truncated FMO4 variant expressed as an active enzyme with catalytic properties typical of other FMO family members . This approach demonstrates that the translational difficulties associated with intact FMO4 can be completely overcome by C-terminal modifications without compromising enzymatic function.

For modern expression systems, researchers have successfully employed a Golden Gate cloning method using pBAD plasmids modified to express the target protein fused at its N-terminus to an N-6xHis-tag-SUMO protein . The cloning mixture typically includes precisely calculated ratios of FMO insert to vector (2:1 molar ratio), appropriate restriction enzymes (BsaI-HF V2), T4 DNA ligase, and buffer, followed by a specific thermal cycling protocol for optimal recombination efficiency .

How does FMO4 contribute to cancer cell survival mechanisms?

FMO4 plays a critical role in cancer cell survival by protecting against ferroptosis, a form of regulated cell death characterized by iron-dependent lipid peroxidation. Mechanistically, FMO4 facilitates the interaction between methionine adenosyltransferase 2A (MAT2A) and its regulatory subunit MAT2B . This interaction promotes the generation of cysteine from methionine, which subsequently enhances the production of glutathione, a crucial antioxidant that protects cancer cells from oxidative damage and ferroptosis .

In vivo deletion of FMO4 in KRAS-driven lung adenocarcinoma mouse models results in significantly decreased tumor burden and increased survival, highlighting its essential role in tumor biology . This finding is corroborated by the observation that FMO4 loss of function promotes ferroptosis and cooperates with ferroptosis inducers both in vitro and in vivo . These data collectively identify FMO4 as a potential therapeutic target in lung adenocarcinoma, where its inhibition could sensitize cancer cells to ferroptosis-inducing agents.

What is the evolutionary basis for functional specialization of FMO4?

The functional specialization of FMO4 within the broader FMO family is rooted in evolutionary divergence that shaped its substrate specificity and catalytic properties. Research on ancestral FMO reconstruction has identified specific amino acid substitutions that occurred during tetrapod evolution, particularly at branch points separating different FMO lineages . These evolutionary changes affected residues in the active site, substrate/product tunnels, FAD-binding domain, and NADPH interaction regions, collectively determining the functional trajectory of FMO4 .

Mechanistically, a distinguishing feature of FMOs is the dual role of NADPH as both electron donor and catalytic element. NADPH first reduces the flavin and then undergoes a conformational change to position its carbamide group within hydrogen bonding distance of the flavin's N5 atom, promoting formation of the flavin-(hydro)peroxide intermediate that is essential for substrate oxygenation . Kinetic analyses reveal that ancestral FMO enzymes react with oxygen in a two-step process yielding species with spectral properties consistent with C4a-(hydro)peroxyflavin intermediates, with reaction rates that reflect their evolutionary adaptation to specific metabolic niches .

How can mutational analysis be used to study FMO4 function?

Robust mutational analysis of FMO4 requires a systematic approach integrating bioinformatic prediction with structural considerations. An effective strategy involves selecting candidate residues based on three primary criteria: (1) the accuracy of evolutionary reconstruction for the specific site, preferably with posterior probability >0.8; (2) the degree of conservation across the FMO family or within specific functional lineages; and (3) the structural environment of each site based on available crystal structures or reliable models .

Once candidate residues are identified, they should be categorized based on their location in functional domains (FAD-binding domain, NADPH-binding domain, or substrate-binding regions) and their position within the protein architecture (surface vs. core residues). This classification helps eliminate residues unlikely to affect function and prioritizes those with potential mechanistic significance . Mutations should then be introduced incrementally, testing combinations of substitutions to dissect their individual and collective contributions to catalytic activity, substrate specificity, or protein stability.

For FMO4 specifically, focusing on residues that differentiate it from other FMO isoforms, particularly those in the extended C-terminal region or active site, provides valuable insights into its unique functional properties .

What expression systems and protocols yield optimal recombinant FMO4 production?

For optimal expression of recombinant FMO4, E. coli remains the preferred system when using the truncated FMO4 variant with a repositioned stop codon . The expression protocol should include the following key steps:

  • Vector selection: Use a pBAD-based expression vector with an N-terminal 6xHis-SUMO fusion tag to enhance solubility and facilitate purification .

  • Transformation protocol: Add 5.0 μl of plasmid DNA to 100 μl CaCl₂-competent E. coli cells (preferably NEB10β strain) and incubate for 30 minutes on ice, followed by heat shock at 42°C for 30 seconds and 5 minutes recovery on ice. Add 500 μl LB-SOC medium and allow cells to recover at 37°C for 1 hour before plating on LB-agar containing 100 μg/ml ampicillin .

  • Expression conditions: Culture transformants at 30°C rather than 37°C to reduce inclusion body formation. Induce expression with 0.02-0.2% arabinose when OD₆₀₀ reaches 0.6-0.8, and continue expression for 16-18 hours at 20°C to maximize yield of soluble protein.

  • Lysis and purification: Use mild detergents in the lysis buffer (0.1% Triton X-100) and include 20% glycerol throughout purification to stabilize the enzyme. Include FAD (10 μM) in all buffers to ensure maximal incorporation in the recombinant enzyme.

This optimized protocol typically yields 2-5 mg of functional enzyme per liter of culture when using the truncated FMO4 variant, whereas the full-length protein remains challenging to express even under these conditions .

What assays are most appropriate for measuring FMO4 enzymatic activity?

Several assay systems are suitable for measuring FMO4 enzymatic activity, each with specific advantages:

  • Spectrophotometric NADPH consumption assay: This approach monitors the decrease in absorbance at 340 nm as NADPH is oxidized during the enzymatic reaction. The standard reaction mixture contains 0.2 mM NADPH, 50 mM phosphate buffer (pH 7.4), appropriate substrate concentration, and purified FMO4 enzyme. The reaction is initiated by adding substrate after pre-incubation with NADPH to form the flavin-hydroperoxide intermediate.

  • HPLC-based metabolite detection: For more definitive characterization, HPLC separation coupled with UV, fluorescence, or mass spectrometric detection allows direct quantification of specific metabolites. This approach is particularly valuable for distinguishing between multiple potential products when using complex substrates.

  • Model substrate assays: Several established substrates can be used to assess FMO4 activity:

    • Methimazole S-oxidation (spectrophotometric detection at 412 nm with DTNB)

    • Benzydamine N-oxidation (HPLC with fluorescence detection)

    • Tamoxifen N-oxidation (HPLC-MS/MS quantification)

  • Oxygen consumption measurements: Using an oxygen electrode to monitor oxygen uptake during catalysis provides direct evidence of monooxygenase activity and can differentiate between uncoupled NADPH oxidation and productive substrate turnover.

When interpreting FMO4 activity data, it's essential to include appropriate controls, particularly comparison with other FMO isoforms to establish substrate specificity patterns and inclusion of heat-inactivated enzyme controls to account for non-enzymatic oxidation.

What approaches can be used to study FMO4's role in ferroptosis?

To investigate FMO4's role in ferroptosis, researchers should employ a multi-faceted approach combining genetic manipulation, pharmacological intervention, and biochemical analysis:

  • Genetic manipulation techniques:

    • CRISPR/Cas9-mediated knockout of FMO4 in relevant cell lines

    • siRNA or shRNA-mediated knockdown for temporary suppression

    • Overexpression systems using wild-type or mutant FMO4 constructs

    • In vivo deletion in mouse models, as demonstrated in KRAS-driven lung adenocarcinoma models

  • Ferroptosis assessment methods:

    • Measurement of lipid peroxidation (BODIPY-C11 staining, TBARS assay)

    • Glutathione depletion quantification

    • Iron chelation rescue experiments

    • Cell death assessments with ferroptosis inhibitors (ferrostatin-1, liproxstatin-1) as controls

  • Metabolic pathway analysis:

    • Quantification of methionine cycle intermediates

    • Measurement of cysteine and glutathione levels

    • Analysis of MAT2A/MAT2B complex formation using co-immunoprecipitation or proximity ligation assays

    • Assessment of reactive oxygen species levels

  • Combination approaches:

    • Testing synergy between FMO4 inhibition and ferroptosis inducers (erastin, RSL3)

    • Analysis of gene expression changes following FMO4 modulation

    • Investigation of potential compensatory mechanisms involving other antioxidant systems

This integrated approach helps establish both the direct involvement of FMO4 in ferroptosis resistance and the downstream biochemical pathways through which it exerts its protective effects on cancer cells .

How should researchers interpret FMO4 expression data in clinical samples?

When analyzing FMO4 expression in clinical samples, researchers should consider several important factors:

This comprehensive analytical approach ensures robust interpretation of FMO4 expression data in the context of cancer biology and potential clinical applications.

What considerations are important when analyzing structure-function relationships in FMO4?

Analysis of structure-function relationships in FMO4 requires careful attention to several key aspects:

This integrated analytical framework enables researchers to develop mechanistic insights into FMO4 function and identify potential targets for modulation in therapeutic contexts.

How can researchers optimize in vivo studies of FMO4 in cancer models?

For effective in vivo investigation of FMO4 in cancer models, researchers should consider the following optimization strategies:

  • Model selection: Choose genetically engineered mouse models (GEMMs) that recapitulate key molecular features of human cancers. For lung adenocarcinoma studies, KRAS-driven models have proven effective for investigating FMO4 function . Consider using conditional systems that allow temporal control of genetic modifications.

  • Genetic manipulation approaches:

    • For constitutive knockout: Target the FMO4 gene while maintaining the integrity of neighboring FMO genes in the cluster

    • For conditional studies: Implement Cre-loxP systems with tissue-specific promoters

    • For temporal control: Consider doxycycline-inducible systems to study FMO4 depletion at different stages of tumor progression

  • Endpoint analysis optimization:

    • Tumor burden: Use standardized quantification methods such as micro-CT imaging for lung tumors

    • Survival analysis: Establish clear humane endpoints and use Kaplan-Meier curves with log-rank tests

    • Molecular profiling: Implement multi-omics approaches (transcriptomics, proteomics, metabolomics) to comprehensively assess downstream effects of FMO4 modulation

  • Therapeutic intervention strategies:

    • For ferroptosis studies: Test combinations of FMO4 inhibition with established ferroptosis inducers

    • Include appropriate control groups treated with ferroptosis inhibitors to confirm mechanism specificity

    • Establish pharmacodynamic markers to confirm target engagement in vivo

  • Translational considerations:

    • Correlate findings with human patient samples

    • Validate key observations across multiple model systems

    • Develop clinically relevant biomarkers based on FMO4 expression or activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.