Recombinant Rabbit fibroma virus E3 ubiquitin-protein ligase LAP (s153R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
s153R; E3 ubiquitin-protein ligase LAP; Leukemia associated protein; LAP; RING-type E3 ubiquitin transferase LAP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Rabbit fibroma virus (strain Kasza) (RFV) (Shope fibroma virus (strain Kasza))
Target Names
s153R
Target Protein Sequence
MSTIVDMVDVSLVDKCCWICKESCDVVRNYCKCRGDNKIVHKECLEEWINTDTVKNKSCA ICETPYNVKQQYKKLTKWRCYRRDCHDSLLVNLPLCLIVGGISTYTLVSVEIIKLMESEE TSELTKVFLVTSFLGPFIVTVLSALRTCIDCRTYFLTTRKRNTIHTLQELEDDDDDDDDD DDDDDEEYADAVEEIIIGPSN
Uniprot No.

Target Background

Function

This E3 ubiquitin-protein ligase facilitates the ubiquitination and subsequent degradation of host MHC-I and CD4 molecules. This mechanism likely prevents lysis of infected cells by cytotoxic T lymphocytes and NK cells. The protein binds target molecules via transmembrane interaction. Ubiquitination enhances endocytosis of the target molecule, leading to lysosomal delivery and proteolytic destruction.

Database Links

KEGG: vg:1486990

Protein Families
Poxviridae LAP protein family
Subcellular Location
Host membrane; Multi-pass membrane protein. Host Golgi apparatus, host trans-Golgi network membrane. Host early endosome membrane.

Q&A

What is Rabbit fibroma virus E3 ubiquitin-protein ligase LAP (s153R)?

Rabbit fibroma virus E3 ubiquitin-protein ligase LAP (s153R) is a viral protein expressed by Shope fibroma virus (strain Kasza), also known as Rabbit fibroma virus (RFV). It functions as an E3 ubiquitin ligase (EC 6.3.2.-) involved in the ubiquitin-proteasome pathway that targets host cellular proteins for degradation or modification . The protein is also known by its alternative name "Leukemia associated protein" (LAP), and the gene encoding it is designated as s153R . The full-length protein consists of 201 amino acids and contains an atypical N-terminal zinc finger motif (C4HC3), also known as a PHD (plant homeodomain) or LAP domain .

What structural domains characterize the LAP (s153R) protein?

The LAP (s153R) protein contains several important structural features that contribute to its function:

  • N-terminal zinc finger motif (C4HC3): This PHD/LAP domain is critical for its E3 ubiquitin ligase activity .

  • C-terminal region: Contains two predicted transmembrane domains that localize the protein to the endoplasmic reticulum (ER) .

  • Complete amino acid sequence: MSTIVDMVDVSLVDKCCWICKESCDVVRNYCKCRGDNKIVHKECLEEWINTDTVKNKSCAICETPYNVKQQYKKLTKWRCYRRDCHDSLLVNLPLCLIVGGISTYTLVSVEIIKLMESEETSELTKV​FLVTSFLGPFIVTVLSALRTCIDCRTYFLTTRKRNTIHTLQELEDDDDDDDDDDDDDEEYADAVEEIIIGPSN .

The protein's structural organization allows it to function within the ER membrane, where it can interact with components of the MHC class I presentation pathway .

How does LAP (s153R) contribute to viral immune evasion?

LAP (s153R) plays a critical role in viral immune evasion through several mechanisms:

  • MHC Class I Downregulation: Similar to the M153R protein in myxoma virus, LAP (s153R) likely contributes to the profound loss (>90%) of class I MHC molecules on infected cells . This downregulation helps the virus evade detection by CD8+ cytotoxic T lymphocytes.

  • Disruption of Antigen Presentation: The protein appears to interfere with the MHC trafficking pathway by localizing to the endoplasmic reticulum via its C-terminal transmembrane domains . This localization is essential for class I MHC downregulation.

  • Ubiquitination-Mediated Degradation: As an E3 ubiquitin ligase, LAP (s153R) likely marks host immune proteins for proteasomal degradation, contributing to comprehensive immune evasion .

The mechanism is similar to that employed by the K3 and K5 proteins of human herpesvirus-8 (HHV-8), which promote the preferential loss of β2-microglobulin-associated MHC class I complexes .

What experimental evidence supports LAP (s153R)'s role in MHC downregulation?

While direct experimental evidence for LAP (s153R) is limited in the provided search results, significant insights can be drawn from studies of its homolog, the M153R protein in myxoma virus:

  • Deletion studies: When the M153R gene was deleted from myxoma virus, the loss of class I MHC normally observed during infection was abrogated .

  • CTL susceptibility: Cells infected with M153R-deletion mutant viruses were more susceptible to CTL-mediated cytolysis than those infected with wild-type virus .

  • In vivo studies: The M153R-deletion mutant exhibited decreased virulence in infected rabbits and showed increased mononuclear infiltrates at the primary infection site, indicating enhanced immune recognition .

Given the structural and functional similarities between LAP (s153R) and M153R, researchers can hypothesize similar mechanisms, though direct experimental validation for LAP (s153R) would be necessary to confirm these functions.

What are the optimal storage and handling conditions for recombinant LAP (s153R)?

For optimal stability and activity of recombinant LAP (s153R), the following storage and handling conditions are recommended:

  • Long-term storage: Store at -20°C or -80°C for extended storage periods .

  • Working solution: Maintain working aliquots at 4°C for up to one week .

  • Buffer composition: The protein is typically stored in a Tris-based buffer containing 50% glycerol, optimized for this specific protein .

  • Avoid freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity .

  • Aliquoting: Upon initial thawing, divide the stock solution into smaller working aliquots to minimize freeze-thaw cycles .

These conditions help maintain the structural integrity and functional activity of the recombinant protein for research applications.

What experimental approaches can be used to study LAP (s153R) interactions with host proteins?

Several experimental approaches can be employed to investigate LAP (s153R) interactions with host proteins:

  • Co-immunoprecipitation (Co-IP): To identify physical interactions between LAP (s153R) and potential host targets, particularly components of the MHC class I presentation pathway.

  • Ubiquitination assays: To detect and characterize LAP (s153R)-mediated ubiquitination of host proteins using in vitro ubiquitination systems with recombinant E1, E2, and target proteins.

  • Flow cytometry: To quantify MHC class I downregulation in cells expressing LAP (s153R) compared to control cells.

  • Confocal microscopy: To visualize the subcellular localization of LAP (s153R) and co-localization with ER markers and MHC class I molecules.

  • Mutagenesis studies: To identify critical residues in the zinc finger motif and transmembrane domains required for LAP (s153R) function.

  • RNA interference: To knock down potential host targets and assess their role in LAP (s153R)-mediated immune evasion.

These methodologies can provide comprehensive insights into how LAP (s153R) modulates host cell processes to promote viral survival.

How does LAP (s153R) compare to similar proteins in other poxviruses?

LAP (s153R) belongs to a family of related proteins found across multiple poxviruses. The table below compares key features of these homologous proteins:

VirusProteinStructural FeaturesFunctionReference
Rabbit fibroma virus (RFV)LAP (s153R)PHD/LAP zinc finger motif, Two transmembrane domainsE3 ubiquitin ligase, Likely MHC I downregulation
Myxoma virusM153RPHD/LAP zinc finger motif, Two transmembrane domainsMHC I downregulation, Immune evasion
Swinepox virusSPV homologPHD/LAP zinc finger motifLikely immune modulation
Yaba-like disease virusYLD homologPHD/LAP zinc finger motifLikely immune modulation
Lumpy skin disease virusLSDV homologPHD/LAP zinc finger motifLikely immune modulation

These proteins share the characteristic PHD/LAP zinc finger motif and likely evolved to target similar host immune components, though there may be species-specific adaptations in their mechanisms and targets .

What functional relationship exists between LAP (s153R) and viral pathogenesis?

LAP (s153R) plays a critical role in viral pathogenesis through several interconnected mechanisms:

  • Immune evasion: By downregulating MHC class I, LAP (s153R) helps the virus evade cytotoxic T lymphocyte responses, a key component of the cell-mediated immune (CMI) response .

  • Persistence: The profound compromise of host CMI response associated with rabbit fibroma virus infection likely contributes to viral persistence in the host .

  • Viral growth: By interfering with host anti-viral immunity, LAP (s153R) creates a more permissive environment for viral replication and spread.

  • Contribution to disease phenotype: In related viruses, homologous proteins contribute to virulence. For example, deletion of M153R in myxoma virus results in decreased virulence and increased mononuclear infiltrates at infection sites .

Understanding this functional relationship is crucial for developing potential therapeutic strategies targeting viral immune evasion mechanisms.

How can genome editing approaches be used to study LAP (s153R) function?

Advanced genome editing techniques offer powerful approaches to investigate LAP (s153R) function:

  • CRISPR/Cas9-mediated gene editing:

    • Create LAP (s153R) knockout viruses to assess its contribution to viral replication and immune evasion

    • Introduce point mutations in functional domains to identify critical residues

    • Create domain swaps with homologous proteins from other viruses to investigate functional conservation

  • BAC (Bacterial Artificial Chromosome) mutagenesis:

    • Generate recombinant viruses with fluorescently tagged LAP (s153R) for live-cell imaging

    • Introduce epitope tags for improved biochemical studies

    • Create conditional expression systems to study temporal requirements for LAP (s153R) function

  • Trans-complementation assays:

    • Express LAP (s153R) in cells infected with LAP-deficient viruses to assess functional rescue

    • Identify minimal functional domains through complementation with truncated variants

These approaches can systematically dissect LAP (s153R) function in the context of viral infection and host response.

What potential therapeutic applications could target LAP (s153R)?

Several therapeutic strategies could potentially target LAP (s153R) to combat poxvirus infections:

  • Small molecule inhibitors:

    • Design compounds that specifically inhibit the E3 ubiquitin ligase activity of LAP (s153R)

    • Target the zinc finger domain to disrupt substrate recognition

    • Interfere with ER localization by targeting the transmembrane domains

  • Peptide-based inhibitors:

    • Develop peptides that mimic LAP (s153R) binding sites on host targets

    • Create peptides that disrupt LAP (s153R) dimerization or complex formation

  • Host-directed therapies:

    • Identify and target host pathways that synergize with LAP (s153R) function

    • Modulate ubiquitin-proteasome system components to counteract LAP (s153R) activity

  • Vaccine development:

    • Generate attenuated viruses with modified LAP (s153R) to induce protective immunity

    • Include LAP (s153R) epitopes in subunit vaccines to generate neutralizing antibodies

These approaches could lead to novel antiviral strategies against poxviruses and potentially other viruses that utilize similar immune evasion mechanisms.

What are common technical challenges in working with recombinant LAP (s153R)?

Researchers working with recombinant LAP (s153R) face several technical challenges:

  • Protein solubility: As a transmembrane protein, LAP (s153R) may exhibit poor solubility in aqueous buffers, requiring optimization of expression and purification conditions.

  • Maintaining native conformation: Preserving the functional fold of the zinc finger domain and proper transmembrane topology during recombinant expression.

  • Enzymatic activity assays: Developing reliable, quantitative assays for E3 ubiquitin ligase activity that reflect the protein's native function.

  • Substrate identification: Identifying physiologically relevant substrates among numerous host proteins.

  • Expression toxicity: Potential cytotoxicity when overexpressing viral immune evasion proteins in mammalian cells.

To address these challenges, researchers should consider using specialized expression systems, fusion tags to enhance solubility, and membrane mimetic environments for biochemical studies.

What emerging research questions should investigators explore regarding LAP (s153R)?

Several promising research directions for LAP (s153R) include:

  • Structural biology: Determining the three-dimensional structure of LAP (s153R), particularly its zinc finger domain, to understand substrate recognition and design specific inhibitors.

  • Host-pathogen interface: Characterizing the complete interactome of LAP (s153R) in infected cells using proteomics approaches to identify all potential targets beyond MHC class I.

  • Evolution and adaptation: Investigating how LAP (s153R) and related proteins evolved across different poxviruses and their host-specific adaptations, particularly in the context of host jumps.

  • Regulation mechanisms: Exploring how LAP (s153R) activity is regulated during viral infection, including potential post-translational modifications and protein-protein interactions.

  • Cross-talk with other viral immune evasion strategies: Understanding how LAP (s153R) functions cooperate with other viral immune evasion mechanisms, such as cytokine inhibitors and chemokine-binding proteins .

  • Therapeutic targeting: Developing and testing specific inhibitors of LAP (s153R) as potential antiviral agents, particularly for immunocompromised patients.

These research directions could significantly advance our understanding of poxvirus pathogenesis and contribute to novel therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.