Recombinant Rabbit Gap junction alpha-1 protein (GJA1)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Recombinant GJA1 is generated via cloning the GJA1 gene into expression vectors, followed by purification. Common applications include:

  • Antibody Development: Used as an immunogen to produce monoclonal antibodies (e.g., Invitrogen’s PSH0-32 antibody) .

  • Functional Studies: Investigating GJA1’s role in cardiac conduction, ciliogenesis, and cancer progression .

Cardiac Function

  • Trafficking Mechanism: The truncated isoform GJA1-20k (20 kDa), produced via alternative translation, stabilizes actin filaments to guide full-length GJA1 delivery to cardiac cell borders .

  • Therapeutic Potential: GJA1-20k overexpression preserves gap junction coupling during ischemia, suggesting utility in preventing arrhythmias .

Ciliogenesis

  • Rab11 Interaction: GJA1 depletion disrupts Rab11 trafficking, impairing ciliary axoneme formation in retinal pigment epithelium and Xenopus models .

  • Structural Role: Dominant-negative GJA1 mutants (e.g., Δ234–243) reduce cilia length and number by interfering with microtubule dynamics .

Cancer Biology

  • HCC Progression: GJA1 promotes hepatocellular carcinoma (HCC) cell proliferation and migration by enhancing TGF-β1 signaling in hepatic stellate cells .

  • Metastasis Correlation: Elevated GJA1 expression in HCCLM3 cells (high metastatic potential) suggests a role in tumor aggressiveness .

Functional Domains and Isoforms

Domain/IsoformFunctionBiological Impact
C-terminal tailBinds cytoskeletal proteinsRegulates channel assembly
Transmembrane domainsForms gap junction poreMediates ion/small molecule flux
GJA1-20kStabilizes actin/microtubulesGuides full-length GJA1 trafficking

Challenges and Future Directions

  • Half-Life: Native GJA1 has a short half-life (2–4 hours), complicating therapeutic use .

  • Channel-Independent Roles: Mitochondrial GJA1 regulates apoptosis, while cytoplasmic forms influence cell migration .

  • Disease Linkages: Mutations cause oculodentodigital dysplasia (ODDD) and cardiac malformations, highlighting the need for targeted therapies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are standardly shipped with regular blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development accordingly.
Synonyms
GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
Full Length of Mature Protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function
Gap junction protein that functions as a regulator of bladder capacity. A gap junction is composed of a cluster of closely packed pairs of transmembrane channels, known as connexons, which enable the diffusion of low molecular weight materials between adjacent cells. It may play a pivotal role in auditory physiology by participating in potassium recycling to the cochlear endolymph. As a negative regulator of bladder functional capacity, it enhances intercellular electrical and chemical transmission, thereby sensitizing bladder muscles to cholinergic neural stimuli and promoting their contraction. This protein may be involved in cell growth inhibition through the regulation of NOV expression and localization. Furthermore, it plays a crucial role in gap junction communication within the ventricles.
Gene References Into Functions
  1. These findings suggest that Cx43/miR-206 is implicated in the pathogenesis of early-stage steroid-induced avascular necrosis of the femoral head. PMID: 27450649
  2. Vascular remodeling following stent implantation exhibited variability based on the presence of balloon injury, cholesterol-enriched diet, or a combination of both. PMID: 22330626
  3. The gap junction enhancer AAP10 demonstrated the potential to mitigate the pro-arrhythmic effect of lysophosphatidic acid, potentially through the downregulation of myocardial nonphosphorylated Cx43 expression. PMID: 21624303
  4. Ischemic postconditioning provided protection against I/R injury by attenuating the I/R-induced decrease in mitochondria Cx43 expression. PMID: 20654085
  5. Beyond Cx43 dephosphorylation, downregulation of Cx43 plays a critical role in reduced cell coupling in the failing rabbit heart PMID: 19880431

Show More

Hide All

Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.

Q&A

What is the molecular structure of rabbit GJA1 protein and how does it compare to human GJA1?

Rabbit Gap junction alpha-1 protein (GJA1/Cx43) is a transmembrane protein that forms hexameric connexons in cell membranes, which align with connexons on adjacent cells to create intercellular channels. The mature rabbit GJA1 protein typically consists of approximately 380-382 amino acids, similar to the rat GJA1 that spans amino acids 2-382 .

GJA1 contains four transmembrane domains, two extracellular loops, one cytoplasmic loop, and cytoplasmic N-terminal and C-terminal domains. The protein's structure includes conserved regions across mammalian species with high sequence homology between rabbit and human variants, particularly in the transmembrane domains and extracellular loops which are critical for channel formation and function. The C-terminal domain contains most of the regulatory phosphorylation sites that modulate channel gating and protein turnover.

When comparing rabbit GJA1 to the human ortholog, sequence identity typically exceeds 90%, making rabbit GJA1 a suitable model for many research applications relevant to human pathophysiology. The protein's amino acid sequence includes characteristic connexin family motifs that are essential for proper folding, trafficking, and function .

What are the recommended methods for confirming the identity and purity of recombinant rabbit GJA1?

Multiple complementary techniques should be employed to verify identity and purity of recombinant rabbit GJA1:

  • SDS-PAGE analysis: Should demonstrate a single predominant band at approximately 43 kDa, with purity exceeding 90% for research-grade preparations . Note that phosphorylated forms may exhibit slightly altered migration patterns.

  • Western blotting: Using validated antibodies against GJA1/Cx43, such as the EPR21153 clone that recognizes a conserved epitope across species . Multiple bands between 40-45 kDa may represent different phosphorylation states.

  • Mass spectrometry: For precise molecular weight determination and peptide mapping to confirm sequence integrity. Analyze tryptic digests and compare observed peptide masses to theoretical values.

  • Circular dichroism (CD) spectroscopy: To confirm proper protein folding and secondary structure composition.

  • Functional assays: Gap junction activity can be assessed through dye transfer assays using lucifer yellow or calcein-AM in transfected cells.

Validation MethodExpected ResultCommon Pitfalls
SDS-PAGESingle band at ~43 kDa, >90% purityMultiple bands may indicate degradation or post-translational modifications
Western blotSpecific immunoreactivity at 43 kDaPhosphorylated forms may appear as multiple bands
Mass spectrometryConfirmation of amino acid sequenceSample contamination can obscure results
CD spectroscopyCharacteristic alpha-helical patternImproper refolding can affect secondary structure
Functional assayIntercellular dye transferRequires optimized expression system

What expression systems are most effective for producing functionally active recombinant rabbit GJA1?

The choice of expression system significantly impacts the functionality of recombinant rabbit GJA1:

Bacterial expression systems (E. coli): While commonly used for producing the protein in research quantities , bacterial systems lack the post-translational modification machinery necessary for complete functional maturation. E. coli-expressed GJA1 typically requires refolding protocols and may lack critical phosphorylation patterns. These preparations are most suitable for structural studies, antibody production, or as antigens.

Mammalian expression systems: HEK293 or CHO cells provide superior expression for functional studies as they contain the necessary cellular machinery for proper folding, post-translational modifications, and trafficking of GJA1 to the membrane. These systems produce protein that more closely resembles native GJA1 in terms of phosphorylation states and functional properties.

Insect cell systems: Provide an intermediate option with better post-translational modification capability than bacteria but less complex than mammalian cells. The baculovirus expression system in Sf9 or High Five insect cells offers good yields with partial post-translational modifications.

For functional gap junction studies, mammalian expression systems are strongly recommended despite their higher cost and lower yield, as they produce protein with physiologically relevant modifications essential for channel formation and regulation.

How can recombinant rabbit GJA1 be effectively used to study gap junction assembly and intercellular communication?

Recombinant rabbit GJA1 serves as a powerful tool for investigating gap junction biology through multiple experimental approaches:

Fluorescently tagged GJA1 constructs: Creating fusion proteins with fluorescent tags (e.g., GFP or mCherry) allows real-time visualization of gap junction plaque formation, dynamics, and turnover in living cells. When designing these constructs, the tag should be positioned at the C-terminus to minimize interference with channel assembly, as the N-terminus is critical for proper trafficking.

Reconstitution systems: Purified recombinant GJA1 can be reconstituted into liposomes or lipid bilayers to study channel properties in controlled environments. This approach requires detergent-solubilized protein and careful removal of detergent during reconstitution to form functional channels.

Microinjection studies: Injecting fluorescent dyes (e.g., Lucifer Yellow) into cells expressing recombinant GJA1 can quantitatively assess gap junction communication by measuring dye transfer to adjacent cells. The rate and extent of dye spread correlate with channel functionality.

Co-culture systems: Creating co-cultures of cells expressing recombinant rabbit GJA1 with wild-type or mutant variants allows assessment of heterotypic channel formation and selective permeability.

Electrophysiological techniques: Dual whole-cell patch clamp recordings can directly measure electrical coupling between adjacent cells expressing recombinant GJA1, providing quantitative data on channel conductance and gating properties.

When designing these experiments, researchers should consider that GJA1 function is highly regulated by phosphorylation events mediated by kinases including PKA, PKC, and MAPKs, which affect channel assembly, gating, and internalization.

What role does GJA1 play in hepatocellular carcinoma progression and how can recombinant GJA1 be used to study this mechanism?

GJA1 has emerged as a significant factor in hepatocellular carcinoma (HCC) progression through complex mechanisms involving both direct effects on cancer cells and modulation of the tumor microenvironment:

Role in HCC progression: GJA1 is correlated with recurrences and unfavorable prognoses in HCC patients. It is specifically expressed by activated hepatic stellate cells (HSCs) in the tumor microenvironment . GJA1 expression varies across different HCC cell lines, with higher expression observed in cell lines with greater malignant potential, such as HCCLM3 cells derived from MHCC97-H cells, which have high metastatic potential .

Experimental approaches using recombinant GJA1:

  • Gain/loss-of-function studies: Recombinant GJA1 can be overexpressed in low-expressing HCC cell lines (e.g., Hep3B, PLC-PRF-5) or knocked down in high-expressing lines (e.g., HCCLM3) to assess its direct impact on proliferation and migration. Research has demonstrated that GJA1 overexpression significantly increases proliferation of HCC cells, while GJA1 knockdown decreases proliferation .

  • Co-culture models: Designing co-culture systems of HSCs and HCC cells with modulated GJA1 expression can reveal intercellular communication mechanisms. Researchers can use recombinant GJA1 with fluorescent tags to visualize gap junction formation between these cell types.

  • TGF-β pathway interactions: Recombinant GJA1 can be used to study the interplay between GJA1 and TGF-β signaling, as GJA1 appears to be a downstream target of TGF-β necessary for HSC activation and migration . This involves exposing cells to TGF-β with or without GJA1 modulation and assessing changes in cellular behavior.

  • Mechanistic studies: Recombinant GJA1 combined with specific inhibitors of downstream pathways can help delineate the signaling cascades through which GJA1 promotes HCC progression. Gene Set Enrichment Analysis has been used to identify pathways influenced by GJA1 expression .

Experimental ApproachKey Findings in HCC ResearchMethodological Considerations
GJA1 overexpressionIncreases HCC cell proliferation from 48-96hOptimal expression vector selection critical
GJA1 knockdownDecreases HCCLM3 cell proliferationsiRNA/shRNA design affects specificity
TGF-β treatmentAccelerates HSC activation with elevated GJA1Timing of treatment affects outcomes
Migration assaysGJA1 promotes migration of both HSCs and HCC cellsBoth Transwell and wound healing assays recommended

How can recombinant rabbit GJA1 be used to investigate cell-specific differences in gap junction formation and function?

Recombinant rabbit GJA1 provides a standardized tool for comparative studies across different cell types, allowing researchers to isolate cell-specific factors that influence gap junction biology:

Transfection into diverse cell lines: By introducing identical recombinant rabbit GJA1 constructs into different cell types (cardiomyocytes, neurons, hepatocytes, fibroblasts, etc.), researchers can identify cell-specific factors that influence channel assembly, localization, and function. This approach controls for GJA1 sequence variability while highlighting the impact of the cellular environment.

Chimeric constructs: Creating domain-swapped chimeras between rabbit GJA1 and other connexin family members allows mapping of domain-specific functions and compatibility across different cell types. This is particularly useful for identifying regions responsible for selective permeability or regulatory sensitivity.

Interactome analysis: Affinity-purified recombinant rabbit GJA1 can be used as bait in pull-down or co-immunoprecipitation experiments to identify cell-type-specific binding partners that modulate gap junction formation and regulation. Mass spectrometry analysis of these interactomes reveals potential regulatory proteins that differ between cell types.

Phosphoproteomic profiling: Comparing the phosphorylation patterns of recombinant rabbit GJA1 expressed in different cell types can reveal cell-specific kinase activities that differentially regulate gap junction function. Phospho-specific antibodies or mass spectrometry can map these modifications.

Combined with CRISPR screens: Recombinant rabbit GJA1 expression combined with genome-wide CRISPR screens can identify cell-type-specific genes required for proper gap junction assembly and function, revealing potential therapeutic targets for diseases involving aberrant gap junction activity.

For robust results, researchers should consider using inducible expression systems to control the timing and level of GJA1 expression across cell types, as excessive overexpression can lead to artifact formation and non-physiological behaviors.

What are the critical phosphorylation sites on rabbit GJA1 and how do they regulate gap junction function in different tissues?

GJA1 function is extensively regulated through phosphorylation at multiple sites, primarily located in the C-terminal domain. These modifications control gap junction assembly, channel gating, protein trafficking, and degradation in a tissue-specific manner:

Key phosphorylation sites and their functions:

  • Ser368: Phosphorylated by PKC, this modification reduces channel conductance and communication. In cardiac tissue, this phosphorylation increases during ischemia, potentially as a protective mechanism to limit spread of damage. In contrast, in neural tissue, increased phosphorylation at this site is associated with excitotoxicity.

  • Ser255/Ser279/Ser282: Phosphorylated by MAPK, these modifications are associated with decreased gap junction communication and increased GJA1 internalization. These sites are particularly important during mitosis and in response to growth factor stimulation.

  • Ser365: Phosphorylation by PKA enhances gap junction communication, counteracting the inhibitory effects of PKC-mediated phosphorylation at Ser368. This represents a critical regulatory balance point in tissues like the heart.

  • Tyr247/Tyr265: Phosphorylated by Src kinase, leading to channel closure and gap junction internalization. These modifications are particularly important in the context of cellular stress and inflammation.

Tissue-specific phosphorylation patterns:

In cardiac tissue, GJA1 phosphorylation patterns change dramatically during ischemia and heart failure, with increased PKC-mediated phosphorylation at Ser368 and decreased phosphorylation at Ser365, resulting in reduced gap junction communication. These changes contribute to arrhythmogenesis through conduction slowing and heterogeneity.

In the liver, GJA1 phosphorylation states are dynamically regulated during hepatic stellate cell activation, with TGF-β signaling promoting specific phosphorylation patterns that enhance HSC migration without affecting proliferation . This selective modulation highlights the context-dependent nature of GJA1 phosphorylation effects.

Methodological approaches for studying phosphorylation:

Researchers can use recombinant rabbit GJA1 with phosphomimetic mutations (replacing serines/threonines with aspartate or glutamate) or phospho-null mutations (replacing with alanine) to investigate the functional consequences of specific phosphorylation events. Mass spectrometry-based phosphoproteomic analysis provides a comprehensive view of the phosphorylation landscape in different physiological and pathological conditions.

How can the contradictory reports about GJA1's role in fibrosis and cancer progression be reconciled through experimental design?

The literature contains conflicting findings regarding whether GJA1 suppresses or promotes fibrosis and cancer progression, particularly in hepatocellular carcinoma . These contradictions can be addressed through carefully designed experiments:

Contextual factors to consider:

  • Cell type specificity: GJA1 may have opposing effects in different cell types within the same tissue. For instance, GJA1 in hepatocytes may have different functions compared to GJA1 in hepatic stellate cells or immune cells. Experiments should isolate cell-specific effects using conditional expression systems or cell-type-specific promoters.

  • Expression level threshold effects: GJA1 may exhibit biphasic effects depending on expression levels. Low levels might promote certain cellular processes while high levels inhibit the same processes. Dose-response experiments with titratable expression systems can reveal these threshold effects.

  • Gap junction-dependent vs. independent functions: GJA1 has both channel-forming (gap junction-dependent) and non-junctional (gap junction-independent) functions. Channel-defective GJA1 mutants that maintain protein-protein interactions can help distinguish between these roles.

  • Disease stage-specific effects: GJA1 may have different roles during initiation versus progression of fibrosis or cancer. Temporal control of GJA1 expression or inhibition using inducible systems can reveal stage-specific effects.

Experimental approaches to resolve contradictions:

  • Combined in vitro and in vivo models: Integrate findings from cell culture with animal models to validate results across different complexity levels. In HCC research, this means correlating cell line findings with patient-derived xenografts and clinical samples.

  • Single-cell analysis: Use single-cell RNA-seq and proteomics to identify heterogeneous responses to GJA1 modulation within seemingly homogeneous populations, potentially explaining contradictory population-level observations.

  • Pathway analysis: Conduct comprehensive pathway analysis when modulating GJA1 expression, as performed with Gene Set Enrichment Analysis , to identify context-dependent signaling networks activated by GJA1.

  • Interactome mapping: GJA1 may interact with different protein partners in different contexts, leading to divergent outcomes. Identifying context-specific interactomes can help explain contradictory findings.

By systematically addressing these factors, researchers can develop a more nuanced understanding of GJA1's role in disease, potentially reconciling apparently contradictory findings through a context-dependent model of GJA1 function.

What are the most effective strategies for developing GJA1-targeted therapeutics for cardiac and cancer applications?

Developing therapeutics targeting GJA1 requires sophisticated approaches that account for its diverse functions across tissues and disease states:

Therapeutic strategies for cardiac applications:

  • Enhancing gap junction communication: In heart failure and arrhythmias, strategies to preserve GJA1 at intercalated discs and maintain functional coupling are beneficial. Approaches include:

    • Peptide mimetics based on the carboxyl terminus of GJA1 (aCT1) that prevent pathological interactions with ZO-1

    • Small molecules that inhibit GJA1 degradation, particularly targeting Nedd4, the E3 ubiquitin ligase responsible for GJA1 turnover

    • Compounds that inhibit stress-activated kinases that phosphorylate GJA1 at sites promoting internalization

  • Targeting lateralized GJA1: In ischemic heart disease, GJA1 relocates from intercalated discs to lateral cell borders. Therapeutics that prevent this redistribution or selectively target lateralized GJA1 may reduce arrhythmia susceptibility.

Therapeutic strategies for cancer applications:

  • Context-dependent targeting: Given GJA1's dual role in cancer, targeting strategies must be tailored to specific cancer types and stages:

    • In HCC where GJA1 promotes progression, inhibitors of GJA1 expression or function in hepatic stellate cells could reduce tumor-stroma communication

    • Peptide inhibitors that disrupt specific GJA1 interactions with oncogenic signaling molecules, rather than blocking all gap junction communication

  • Combination therapies: GJA1-targeted approaches may be most effective when combined with standard treatments:

    • GJA1 inhibitors could enhance chemosensitivity by preventing the spread of survival signals between tumor cells

    • Inhibiting GJA1 in activated hepatic stellate cells could reduce TGF-β-mediated effects on the tumor microenvironment

Drug development considerations:

  • Target validation: Using recombinant rabbit GJA1 for high-throughput screening of compound libraries to identify molecules that modulate specific aspects of GJA1 function

  • Selectivity challenges: Developing agents that selectively target GJA1 without affecting other connexin family members requires careful design and validation

  • Tissue-specific delivery: Employing nanoparticle-based or antibody-directed delivery systems to target therapeutic agents to specific tissues where GJA1 modulation is desired while sparing others

  • Biomarker development: Establishing phospho-specific GJA1 antibodies as biomarkers to identify patients likely to respond to GJA1-targeted therapies and monitor treatment efficacy

The therapeutic potential of GJA1 targeting is substantial, but successful development requires navigating the complex biology of this multifunctional protein across different physiological contexts.

What are the most common challenges in achieving proper folding and solubility of recombinant rabbit GJA1 and how can they be addressed?

Recombinant GJA1 presents significant technical challenges due to its complex membrane protein structure with multiple transmembrane domains:

Common challenges and solutions:

  • Inclusion body formation in bacterial systems: When expressed in E. coli, GJA1 often accumulates in insoluble inclusion bodies . This can be addressed through:

    • Optimization of induction conditions (lower temperature, reduced IPTG concentration)

    • Fusion with solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO

    • Specialized refolding protocols using detergent gradients or lipid-detergent mixed micelles

    • Consideration of alternative expression systems for functional studies

  • Detergent selection for solubilization: The choice of detergent critically affects GJA1 stability and functionality:

    • Mild detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) better preserve native structure

    • Detergent screening should assess both solubilization efficiency and maintenance of secondary structure

    • Reconstitution into nanodiscs or liposomes after purification can enhance stability for functional studies

  • Oxidative damage during purification: GJA1 contains cysteine residues in extracellular loops that form disulfide bonds essential for proper folding:

    • Including reducing agents (DTT or β-mercaptoethanol) at appropriate concentrations and stages

    • Performing purification steps under nitrogen atmosphere when possible

    • Adding antioxidants like vitamin C to buffers to minimize oxidative damage

  • Storage stability issues: Purified GJA1 often shows limited stability during storage:

    • Lyophilization with appropriate cryoprotectants like trehalose (6%) maintains structure

    • Aliquoting and storing at -80°C prevents freeze-thaw damage

    • Addition of 5-50% glycerol improves long-term stability

Advanced strategies for difficult constructs:

  • Split inteins approach: Expressing GJA1 as two separate fragments that self-assemble through protein trans-splicing, reducing the challenge of expressing the full protein at once

  • Cell-free expression systems: Using cell-free protein synthesis with the addition of lipids or detergents during translation to facilitate proper folding

  • Directed evolution: Applying protein engineering approaches to identify GJA1 variants with improved expression and solubility while maintaining key functional properties

How can researchers effectively compare results across studies using different recombinant GJA1 preparations and expression systems?

Comparing results across different GJA1 studies is challenging due to variability in protein preparation, expression systems, and experimental conditions. Researchers should consider the following strategies for meaningful comparisons:

Standardization approaches:

  • Comprehensive protein characterization: Before functional studies, each GJA1 preparation should be characterized for:

    • Purity (>90% by SDS-PAGE)

    • Proper folding (circular dichroism spectroscopy)

    • Phosphorylation status (phospho-specific antibodies or mass spectrometry)

    • Oligomerization state (blue native PAGE or size exclusion chromatography)

  • Reference standards: Include well-characterized GJA1 controls in experiments:

    • Commercial recombinant GJA1 with established properties

    • Wild-type GJA1 alongside mutant variants

    • Multiple expression systems in parallel studies to identify system-specific effects

  • Validated functional assays: Employ standardized assays that provide quantitative measures of GJA1 function:

    • Dye transfer assays with consistent dye concentration and exposure time

    • Electrophysiological measurements with defined recording conditions

    • Trafficking assays with consistent imaging parameters and quantification methods

Data normalization strategies:

  • Internal controls: Express results relative to wild-type GJA1 produced in the same system under identical conditions

  • Multi-parameter assessment: Evaluate GJA1 function using multiple complementary assays to build a comprehensive functional profile

  • Meta-analysis approaches: When comparing across published studies, apply statistical methods that account for inter-study variability and different experimental conditions

Reporting standards for publication:

Researchers should report detailed information about their GJA1 preparations:

ParameterEssential Reporting Elements
Construct detailsExact amino acid sequence, tags, linkers, species of origin
Expression systemCell type, culture conditions, induction method
Purification methodDetailed protocol, buffer composition, detergents used
Protein characterizationPurity assessment, oligomeric state, post-translational modifications
Storage conditionsBuffer composition, temperature, additives, duration
Functional validationSpecific assays used to confirm activity

By adhering to these standards, researchers can better integrate findings across different studies and build a more cohesive understanding of GJA1 biology.

What are the most sensitive and reproducible methods for assessing the functional activity of recombinant rabbit GJA1 in different experimental systems?

Assessing GJA1 functionality requires techniques that can detect gap junction formation, channel permeability, and regulatory responses:

Gap junction formation assays:

  • Immunofluorescence microscopy: Visualizes GJA1 localization at cell-cell interfaces using specific antibodies or fluorescently tagged recombinant GJA1. Quantification of gap junction plaques (size, number, and distribution) provides insights into assembly efficiency.

  • Freeze-fracture electron microscopy: The gold standard for visualizing gap junction ultrastructure, revealing the characteristic arrays of connexons in the membrane. This technique can distinguish between assembled channels and non-functional protein aggregates.

  • FRAP (Fluorescence Recovery After Photobleaching): Measures lateral mobility of fluorescently tagged GJA1 in the membrane, with reduced mobility indicating incorporation into gap junction plaques.

Channel functionality assays:

  • Dye transfer assays: Quantitative assessment of gap junction communication through transfer of gap junction-permeable fluorescent dyes:

    • Microinjection of Lucifer Yellow (MW 457 Da, -2 charge)

    • Scrape-loading of dyes into monolayers of cells

    • Parachute assay where donor cells preloaded with calcein-AM are dropped onto receiver cells

    • FRAP-based methods measuring fluorescence recovery via gap junctions rather than lateral diffusion

  • Electrophysiological techniques:

    • Dual whole-cell patch clamp: The most direct and quantitative measure of gap junction conductance

    • Microelectrode array (MEA) recordings: For assessing electrical coupling in cell monolayers

    • Impedance measurements: For high-throughput screening of gap junction function

  • Metabolite transfer assays: Measuring transfer of biologically relevant molecules like cAMP, ATP, or IP3 between cells expressing recombinant GJA1.

Regulatory response assays:

  • Phosphorylation-dependent functional changes: Treating cells with PKC activators (e.g., PMA) should reduce GJA1-mediated communication, while PKA activators (e.g., forskolin) should enhance it. These responses indicate properly regulated channels.

  • pH sensitivity: Functional GJA1 channels should demonstrate characteristic closure in response to intracellular acidification, which can be monitored using pH-sensitive dyes along with gap junction communication assays.

  • Calcium sensitivity: Gap junction communication mediated by GJA1 should decrease with elevated intracellular calcium, a response that can be monitored during calcium imaging experiments.

For the most robust assessment, researchers should employ multiple complementary techniques, as each provides distinct information about GJA1 functionality. The choice of assays should be tailored to the specific research question and experimental system.

How might advanced structural biology techniques enhance our understanding of GJA1 regulation and drug development?

Recent advances in structural biology offer unprecedented opportunities to deepen our understanding of GJA1 regulation and accelerate therapeutic development:

Cryo-electron microscopy (cryo-EM): The revolution in cryo-EM technology now enables determination of membrane protein structures at near-atomic resolution. For GJA1 research, this offers several advantages:

  • Visualization of complete gap junction channels in different functional states (open, closed, partially open)

  • Mapping of protein-protein interaction interfaces with regulatory partners

  • Identification of conformational changes induced by phosphorylation or other post-translational modifications

  • Structure determination in lipid environments that better mimic physiological conditions

X-ray free electron laser (XFEL) crystallography: This emerging technique allows structural studies of membrane proteins in microcrystals, potentially revealing:

  • Dynamic structural changes during channel gating with microsecond time resolution

  • Effects of membrane composition on GJA1 conformation and packing

  • Binding sites for regulatory molecules in their native conformations

Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique provides insights into protein dynamics and conformational changes:

  • Mapping regions of GJA1 that undergo conformational changes upon binding of regulatory partners

  • Identifying dynamic elements involved in channel gating

  • Characterizing the effects of disease-causing mutations on protein flexibility and stability

Integrative structural biology approaches: Combining multiple experimental techniques with computational modeling:

  • Integrating cryo-EM, cross-linking mass spectrometry, and molecular dynamics simulations to build comprehensive structural models

  • Developing more accurate in silico screening methods for GJA1-targeted drug discovery

  • Creating predictive models of how phosphorylation patterns affect channel structure and function

These structural advances have direct implications for therapeutic development:

  • Structure-based design of peptides or small molecules that target specific regulatory interfaces

  • Rational design of GJA1 mutations with enhanced or modified properties for gene therapy applications

  • Development of allosteric modulators that stabilize particular functional states of the channel

What emerging technologies might revolutionize our ability to study GJA1 dynamics and function in living systems?

Several cutting-edge technologies are poised to transform GJA1 research by enabling more sophisticated analysis of its dynamics and function in living systems:

Advanced imaging technologies:

  • Super-resolution microscopy: Techniques like STORM, PALM, and STED break the diffraction limit, allowing visualization of individual gap junction channels and their dynamic assembly/disassembly:

    • Tracking single-molecule movements of GJA1 within the membrane

    • Resolving substructures within gap junction plaques

    • Visualizing interactions between GJA1 and cytoskeletal elements

  • Optogenetics applied to gap junctions: Development of light-controlled GJA1 variants allows precise temporal control of gap junction function:

    • Incorporating photoswitchable amino acids into GJA1 structure

    • Optically triggered post-translational modifications

    • Light-controlled association/dissociation of regulatory proteins

  • FRET-based sensors: Genetically encoded sensors to monitor GJA1 conformational changes and interactions in real-time:

    • GJA1 constructs with intramolecular FRET pairs to detect conformational changes

    • Intermolecular FRET to monitor protein-protein interactions

    • Sensors that detect phosphorylation-induced conformational changes

Genetic and cellular engineering approaches:

  • CRISPR-based technologies:

    • Base editing for precise modification of specific residues within the endogenous GJA1 gene

    • CRISPRa/CRISPRi for temporal control of GJA1 expression levels

    • CRISPR screens to identify novel regulators of GJA1 function

  • Synthetic biology approaches:

    • Engineered cells with orthogonal gap junction systems for studying channel composition effects

    • Reconstitution of minimal gap junction communication systems

    • Development of synthetic regulatory circuits that respond to or control gap junction activity

Multi-omics integration:

  • Spatial transcriptomics and proteomics: Mapping the expression and modification landscape of GJA1 within tissues with subcellular resolution:

    • Correlating GJA1 expression patterns with functional outcomes in complex tissues

    • Identifying microenvironmental factors that influence GJA1 regulation

    • Mapping phosphorylation states across tissue regions

  • Metabolomics combined with gap junction analysis: Comprehensively tracking the movement of metabolites through gap junctions:

    • Identifying the full spectrum of endogenous molecules that pass through GJA1 channels

    • Understanding how channel selectivity changes under different physiological conditions

    • Correlating metabolite transfer with functional outcomes in complex tissues

These emerging technologies will enable researchers to move beyond static snapshots of GJA1 function to dynamic, integrated understanding of how this crucial protein operates within living systems.

How might organ-on-a-chip and organoid technologies advance our understanding of GJA1 in tissue-specific functions and disease modeling?

Organ-on-a-chip and organoid technologies offer unprecedented opportunities to study GJA1 in physiologically relevant, three-dimensional environments that recapitulate key aspects of tissue architecture and function:

Cardiac applications:

  • Heart-on-a-chip models: Microfluidic devices containing aligned cardiomyocytes allow precise measurement of:

    • Conduction velocity and patterns in cardiac tissues with modified GJA1 expression

    • Effects of pharmacological GJA1 modulators on synchronous contraction

    • Arrhythmia susceptibility under controlled stress conditions (hypoxia, inflammation)

    • Interaction between mechanical forces and GJA1 regulation

  • Cardiac organoids: 3D self-organizing structures that develop chamber-like regions:

    • Study of GJA1 distribution and function during cardiac chamber specification

    • Modeling congenital heart defects associated with GJA1 mutations

    • Long-term effects of GJA1 modification on cardiac remodeling

Liver applications:

  • Liver-on-a-chip systems: Incorporating multiple cell types (hepatocytes, stellate cells, Kupffer cells) to study:

    • Cell-type-specific roles of GJA1 in liver physiology and disease

    • Intercellular communication patterns during fibrosis development

    • GJA1-mediated interactions between hepatocytes and non-parenchymal cells

    • Role of GJA1 in TGF-β-mediated hepatic stellate cell activation in a three-dimensional context

  • Liver organoids: More complex 3D structures with hepatocyte-like cells arranged in lobule-like architecture:

    • Zonation of GJA1 expression and function across the porto-central axis

    • Modeling hepatocellular carcinoma with altered GJA1 function

    • Testing GJA1-targeting therapeutics in patient-derived organoids

Multi-organ-on-chip platforms: Connecting different tissue compartments to study:

  • Systemic effects of altered GJA1 function

  • Organ-specific responses to GJA1-targeting therapeutics

  • Cross-talk between tissues mediated by factors regulated by gap junctional communication

Technical advances that enhance these applications:

  • Real-time monitoring capabilities: Incorporating electrodes, optical sensors, or reporter systems to continuously track GJA1 function:

    • Impedance measurements across the chip to monitor gap junction coupling

    • Genetically encoded calcium indicators to visualize calcium wave propagation

    • Metabolite sensors to track intercellular communication

  • Controlled microenvironment: Precise manipulation of factors that influence GJA1 regulation:

    • Oxygen gradients to model hypoxic conditions

    • Inflammatory cytokine gradients

    • Mechanical stiffness variation to mimic different disease states

  • Patient-specific disease modeling: Using cells derived from patients with GJA1 mutations or diseases:

    • Testing personalized therapeutic approaches

    • Investigating genetic modifiers that affect GJA1-related phenotypes

    • Modeling complex diseases where GJA1 plays a contributory but not causative role

These technologies bridge the gap between simplified cell culture models and complex animal systems, offering controlled yet physiologically relevant platforms for GJA1 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.