Recombinant Rabbit Inward rectifier potassium channel 2 (KCNJ2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
KCNJ2; IRK1; Inward rectifier potassium channel 2; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
KCNJ2
Target Protein Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASRESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDMDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI
Uniprot No.

Target Background

Function

Inward rectifier potassium channel 2 (KCNJ2) likely plays a crucial role in establishing action potential waveform and excitability in neuronal and muscle tissues. These channels exhibit a preferential influx of potassium ions into the cell. Their voltage dependence is modulated by extracellular potassium concentration; increasing extracellular potassium shifts the voltage range of channel opening to more positive potentials. Inward rectification is primarily attributed to intracellular magnesium block. Extracellular barium and cesium can inhibit channel activity.

Gene References Into Functions
  1. Significant transmural gradients of Cav1.2, KChIP2, ERG, KvLQT1, Kir2.1, NCX1, SERCA2a, and RyR2 were observed at both mRNA and protein levels (where applicable), consistently showing higher abundance in the epicardium compared to the endocardium. PMID: 22537893
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.
Tissue Specificity
Highly expressed in the ventricle and skeletal muscle, moderately in cerebrum and cerebellum. Only low levels are detected in kidney or lung.

Q&A

What are the primary functional roles of KCNJ2 in cardiac and skeletal muscle, and how do recombinant models replicate these in vitro?

KCNJ2 encodes the inward-rectifying potassium channel Kir2.1, which generates I_K1 current critical for stabilizing resting membrane potentials and regulating excitability in cardiomyocytes and skeletal muscle cells . Recombant systems (e.g., HEK293 or yeast) often co-express KCNJ2 with auxiliary subunits (Kir2.2/Kir2.4) to recapitulate native heteromeric channel configurations . For accurate functional studies:

  • Voltage-clamp protocols: Apply 1s pulses from −120 to +40 mV to measure steady-state currents, normalized to cell capacitance .

  • Purification strategies: Use Fos-choline 14 detergents for solubilization and FLAG-tag affinity chromatography to achieve >90% purity .

How do you select appropriate expression systems for recombinant KCNJ2 production?

SystemAdvantagesLimitationsApplications
Saccharomyces cerevisiaeHigh yield, eukaryotic post-translational modificationsLower human protein compatibilityStructural studies, large-scale purification
HEK293Native-like membrane integrationLower expression efficiencyFunctional electrophysiology
Xenopus oocytesRobust expression for patch-clampLimited post-translational processingRapid functional screening

Key considerations:

  • Yeast: Optimal for structural studies requiring high-purity protein .

  • Mammalian cells: Preferable for studying human disease-associated mutations .

What validated antibodies are recommended for detecting KCNJ2 in rabbit models?

Antibody TypeEpitopeApplicationsCross-ReactivityCitations
Rabbit monoclonal (EPR4530)N-terminal domainIHC-P, WB, ICC/IFHuman, rabbit
Rabbit polyclonal (GTX81647)C-terminal (398–427 aa)ELISA, WB, IHCHuman, mouse

Methodological note:

  • IHC optimization: Use 1:50–1:100 dilutions for rabbit tissues to avoid nonspecific binding .

  • WB validation: Confirm specificity via peptide competition assays .

How do KCNJ2 mutations (e.g., R67Q, R218L) contribute to Andersen-Tawil Syndrome (ATS)?

Loss-of-function KCNJ2 mutations disrupt I_K1 currents, leading to hyperexcitability and arrhythmias . Key findings:

  • Dominant-negative effect: Mutant subunits suppress wild-type channel activity when co-expressed .

  • Sex-specific phenotypes: Female carriers show higher arrhythmia prevalence, while males exhibit periodic paralysis .

  • Structural impact: Molecular dynamics simulations reveal altered Mg²⁺ blockage and reduced channel stability in open states .

Table: Common KCNJ2 Mutations and Phenotypes

MutationLocationFunctional ImpactAssociated Phenotype
R67QN-terminalImpaired Mg²⁺ bindingSevere ATS with dysmorphic features
R218LTransmembraneAltered gating kineticsCatecholaminergic VT-like arrhythmias
G300DC-terminalReduced channel traffickingMild ATS with U-wave abnormalities

How do you design experiments to study KCNJ2 mutation-specific arrhythmogenic mechanisms?

Recommended workflow:

  • Heterologous expression: Transfect Kir2.1 mutants into HEK293 or Xenopus oocytes .

  • Patch-clamp analysis:

    • Whole-cell: Measure I_K1 at −40 mV holding potential .

    • Single-channel: Assess gating kinetics and Mg²⁺ sensitivity .

  • Structural studies: Use cryo-EM or molecular dynamics to map mutation-induced conformational changes .

Statistical considerations:

  • Sample size: Use n ≥ 10 cells per condition to account for biological variability.

  • Data analysis: Compare mutant vs. wild-type currents using ANOVA with Tukey’s post-hoc test .

How do you reconcile conflicting data between in vitro and in vivo models of KCNJ2 dysfunction?

Conflicts often arise due to:

  • Auxiliary subunit interactions: Native channels are heterotetramers (Kir2.1/Kir2.2/Kir2.4), while in vitro studies often use homomers .

  • Post-translational modifications: Absent in recombinant systems but critical in vivo (e.g., phosphorylation) .

Resolution strategies:

  • Co-expression systems: Include Kir2.2/Kir2.4 in HEK293 models .

  • In vivo validation: Use Kcnj2 knock-in mice to confirm arrhythmogenic mechanisms .

What advanced techniques are used to characterize KCNJ2 mutant structures?

Atomic-level methods:

  • Molecular dynamics (MD):

    • RMSD analysis: Assess global stability (e.g., R67Q mutants show higher RMSD in open states) .

    • PCA: Identify dominant conformational changes (e.g., pore helix deviations) .

  • Cryo-EM: Resolve mutant-specific gating defects in near-atomic detail .

Functional validation:

  • Spermine block assays: Test inward rectification properties in inside-out patches .

What challenges exist in targeting KCNJ2 for therapeutic intervention?

ChallengeMechanismPotential Solution
Channel specificityKir2.1 vs. Kir2.2/2.4 subunitsDevelop subunit-selective agonists/antagonists
Dominant-negative effectMutant subunit inhibition of WT channelsGene therapy to replace defective alleles
Drug resistanceAltered binding pockets in mutantsHigh-throughput screening for mutant-specific ligands

How do you statistically analyze genetic association studies for KCNJ2-linked arrhythmias?

Best practices:

  • Genetic screening: Prioritize C-terminal mutations (linked to severe ATS) .

  • Case-control design: Compare mutation frequencies in patients vs. population controls .

  • Bioinformatic tools: Use SIFT/PolyPhen to predict mutation pathogenicity .

  • Replication: Validate findings in ≥2 independent cohorts .

Strategies:

  • Epitope mapping: Use N-terminal (species-conserved) vs. C-terminal (variable) antibodies .

  • Species-specific validation:

    • Rabbit: Use EPR4530 (human/rabbit cross-reactive) .

    • Mouse: Opt for GTX81647 (human/mouse cross-reactive) .

  • Negative controls: Include pre-immune serum or epitope-blocking peptides .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.