Recombinant Rabbit Lens fiber major intrinsic protein (MIP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquot the protein. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MIP; Lens fiber major intrinsic protein; Aquaporin-0
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
MIP
Target Protein Sequence
MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQAVGHISGAHVNPAVTFAFLVGSQMSLLRAICYMAAQLLGAVAGAAVLYSVTPAAVRGNLALNTLHPGVSLGQATTVEIFLTLQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPIIGGGLASLLYDFLLFPRLKSVSERLSILKGARPSDSNGQPEGTGEPVELKTQAL
Uniprot No.

Target Background

Function
This protein functions as a water channel. Its activity is down-regulated by CALM when cytoplasmic Ca(2+) levels increase. It may play a role in regulating lens osmolarity. Interactions between homotetramers from adjacent membranes may stabilize cell junctions in the eye lens core. It contributes to cell-to-cell adhesion and facilitates gap junction coupling.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Lens fiber major intrinsic protein (MIP) and what is its primary function?

Lens fiber major intrinsic protein (MIP), also known as Aquaporin-0 (AQP0), is a member of the water-transporting aquaporin family and the original member of the MIP family of channel proteins. It is abundantly expressed as a lens fiber membrane protein and plays multiple critical roles in lens development, organization, and function .

While MIP functions as a water channel, it is relatively less efficient compared to other aquaporins. Research suggests it also functions as an adhesion molecule between lens fiber cells, facilitating intracellular communication. MIP is exclusively expressed in the vertebrate lens and is essential for maintaining lens transparency . The presence of MIP in lens fiber cell membranes has been implicated in reducing the interfiber space, which is crucial for the optical properties of the lens .

How does MIP expression differ across various regions of the lens?

MIP expression patterns vary across different regions of the lens, correlating with fiber cell differentiation and maturation. MIP is specifically expressed in lens fiber cells, not in lens epithelial cells. The expression pattern reflects the developmental gradient of the lens, with newer fiber cells at the periphery and older cells in the nucleus.

The lipid environment surrounding MIP changes significantly between lens cortex and nucleus regions. The cholesterol to phospholipid ratio (C/PL) increases from approximately 0.6 (mol/mol) in the cortex to about 1.4 (mol/mol) in the nucleus in bovine lenses . Similarly, the ratio of sphingomyelin (SM) to other phospholipids is higher in the lens nucleus than in the lens cortex, with SM constituting approximately 25 mol% of total phospholipid in the cortex and 46 mol% in the nucleus . These compositional differences likely influence MIP's function as a water channel, as research has shown that its water permeability depends on its lipid environment.

How is MIP expression regulated during lens development?

MIP expression is tightly regulated during lens development and fiber cell differentiation. Research has demonstrated that fibroblast growth factor-2 (FGF-2) plays a crucial role in regulating MIP expression in lens cells .

Using real-time PCR techniques on rat lens epithelia explants, researchers have shown that endogenous MIP levels are upregulated upon FGF-2 stimulation in a concentration-dependent manner. This upregulation occurs at the transcriptional level and coincides with the activation of FGF downstream signaling components, specifically the ERK1/2 and JNK pathways .

The regulatory mechanisms have been confirmed through inhibitor studies, where specific inhibitors—UO126 for ERK1/2 and SP600125 for JNK—abrogated MIP expression in response to FGF-2 in the explants. This inhibition pattern was also observed in reporter assays for transfection of rat lens epithelia explants driven by the MIP promoter (-1648/+44) . These findings demonstrate that the ERK1/2 and JNK signaling pathways are essential for MIP expression in lens epithelia cells undergoing FGF-2-induced differentiation.

What techniques are most effective for studying MIP expression in developing lens tissues?

For studying MIP expression in developing lens tissues, researchers employ multiple complementary techniques:

  • Real-time PCR (qPCR): This quantitative technique measures MIP mRNA levels, providing insight into transcriptional regulation. It has been effectively used to demonstrate FGF-2-dependent upregulation of MIP expression in lens explant cultures .

  • Western blotting: Using specific antibodies against MIP (such as rabbit polyclonal antibodies), this technique detects the ~28 kDa MIP protein in lens tissue samples. Western blotting can distinguish MIP from other similar proteins like AQP5, which has recently been demonstrated in lens fiber cells .

  • Immunohistochemistry: IHC-P (paraffin sections) can visualize the spatial distribution of MIP in different regions of the lens, tracking changes during development and differentiation .

  • Reporter assays: Transfection of lens explants with constructs containing the MIP promoter region driving reporter genes allows for studying transcriptional regulation mechanisms, as demonstrated in studies of FGF-2-induced MIP expression .

  • Zebrafish models: Zebrafish have proven useful for studying lens formation and MIP expression patterns during development, offering advantages of rapid development and optical clarity .

What are the optimal conditions for expressing recombinant rabbit MIP in E. coli systems?

For optimal expression of recombinant rabbit MIP in E. coli systems, researchers should consider the following parameters:

Expression system specifications:

  • Host: E. coli (BL21 or similar strain optimized for membrane protein expression)

  • Vector: pET or similar expression vector with T7 promoter

  • Tag: N-terminal His-tag for purification (6x His is common)

  • Full-length construct: Amino acids 1-263 of rabbit MIP

Expression conditions:

  • Induction: IPTG at 0.1-0.5 mM, when OD600 reaches 0.6-0.8

  • Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

  • Duration: Extended expression (overnight) at lower temperatures

Purification considerations:

  • Lysis: Mechanical disruption combined with detergent solubilization

  • Detergents: Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) to maintain protein structure

  • Affinity chromatography: Ni-NTA for His-tagged proteins

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been used successfully

Quality control metrics:

  • Purity: SDS-PAGE analysis (target >90% purity)

  • Western blot: Confirmation with anti-His and anti-MIP antibodies

  • Functional assays: Water permeability measurements in reconstituted proteoliposomes

What are the best methods for assessing the functional activity of recombinant MIP protein?

Assessing the functional activity of recombinant MIP protein requires specialized techniques that evaluate its water channel activity and potential adhesive properties:

  • Proteoliposome water permeability assays:

    • Reconstitute purified MIP into liposomes of defined composition

    • Measure water flux using stopped-flow light scattering techniques

    • Compare osmotic water permeability (Pf) values with appropriate controls

    • Test effects of different lipid compositions to evaluate environmental sensitivity

  • Planar lipid bilayer measurements:

    • Incorporate MIP into planar lipid bilayers

    • Measure single-channel water conductance

    • Evaluate the effects of pH, calcium, and other modulators on channel activity

  • Cell-based assays:

    • Express MIP in cell systems lacking endogenous water channels

    • Measure cell swelling/shrinking rates under osmotic gradients

    • Use fluorescent markers or cell volume measurement techniques

  • Adhesion assays:

    • Evaluate cell-cell adhesion in MIP-expressing cells

    • Measure forces required to separate MIP-containing membranes

    • Compare with adhesion properties of other aquaporins

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Thermal stability assays to determine melting temperature (Tm)

    • Limited proteolysis to assess proper folding

When conducting these assays, it's critical to consider the lipid environment, as research has shown that MIP water permeability is strongly influenced by the lipid composition of the bilayer . Comparing results across different lipid compositions that mimic the natural lens fiber cell membrane can provide valuable insights into physiological regulation.

How do lipid compositions affect MIP water permeability, and what are the methodological approaches to study these effects?

The water permeability of MIP/AQP0 is significantly influenced by its lipid environment, with research demonstrating that permeability varies with different bilayer compositions. To study these effects, researchers employ several methodological approaches:

Experimental approaches:

  • Reconstitution into defined proteoliposomes:

    • Purify recombinant MIP to homogeneity

    • Prepare liposomes with defined lipid compositions

    • Reconstitute MIP at controlled protein-to-lipid ratios

    • Compare systematic variations in:

      • Cholesterol content

      • Sphingomyelin percentage

      • Degree of acyl chain saturation

      • Phospholipid headgroup composition

  • Stopped-flow light scattering measurements:

    • Subject proteoliposomes to osmotic gradients

    • Record time-dependent light scattering changes

    • Calculate osmotic water permeability (Pf) values

    • Analyze temperature dependence to determine activation energy (Ea)

  • Lens lipid extract studies:

    • Extract native lipids from different lens regions (cortex vs. nucleus)

    • Reconstitute MIP into liposomes made from these extracts

    • Compare functionality in cortical vs. nuclear lipid environments

Key findings on lipid effects:

Research has shown that sphingomyelin (SM) and cholesterol content significantly affect MIP function. The bovine lens exhibits a gradient where SM increases from 25 mol% of total phospholipid in the cortex to 46 mol% in the nucleus, while the cholesterol/phospholipid ratio increases from 0.6 to 1.4 . These compositional changes alter bilayer physical properties, including:

  • Membrane thickness

  • Lipid packing density

  • Lateral pressure profile

  • Structural order parameters

These alterations in membrane properties modulate MIP water permeability, potentially serving as a physiological regulatory mechanism adapting water flux to different lens regions .

What are the challenges in replicating the native lens fiber cell membrane environment for functional studies of MIP?

Replicating the native lens fiber cell membrane environment for functional MIP studies presents several significant challenges:

  • Complex and gradient lipid composition:

    • The lens exhibits a spatial gradient of lipid composition from cortex to nucleus

    • Sphingomyelin (SM) content increases from cortex (25 mol%) to nucleus (46 mol%)

    • Cholesterol/phospholipid ratio increases from 0.6 in cortex to 1.4 in nucleus

    • Some species (e.g., humans) contain dihydrosphingomyelin (DHSM) instead of SM

    • Saturated hydrocarbon chains are enriched in nuclear lipids by a factor of 4 compared to cortical lipids

  • Recreating proper protein-protein interactions:

    • MIP interacts with other lens proteins including other AQPs (e.g., AQP5)

    • Intermediate filament proteins (vimentin, CP49, filensin) display temporal expression patterns that influence MIP function

    • MP19 and other membrane proteins contribute to the native environment

  • Technical limitations in membrane mimetics:

    • Liposomes lack cytoskeletal elements present in native membranes

    • Planar bilayers cannot replicate curved membrane domains

    • Detergent solubilization during purification may alter protein conformation

  • Developmental and regional specificity:

    • Lens fiber cells undergo dramatic changes during differentiation

    • Cells in different regions have distinct membrane compositions

    • MIP post-translational modifications vary across lens regions

  • Methodological table comparing membrane mimetic systems:

Membrane SystemAdvantagesLimitationsApplicability to MIP Studies
LiposomesControl over lipid composition; Amenable to permeability assaysLack cytoskeletal interactions; High curvatureGood for initial permeability studies with defined lipids
NanodiscsControlled size; Bilayer access from both sidesSmall size limits protein-protein interactionsUseful for structural studies of MIP in membrane
Planar bilayersElectrical measurements possible; Flat geometryLimited compositional complexityLimited value for MIP (non-ion channel)
Cell membrane fragmentsContain native interacting proteinsHeterogeneous composition; Difficult manipulationGood for studying MIP in near-native environment
Xenopus oocytesExpression of functional protein; Whole-cell assaysOocyte membranes differ from lens (C/PL ratio 0.3 vs. 0.6-1.4 in lens) Useful for expression but not for lipid interaction studies

Researchers must consider these challenges when designing experiments and interpreting results from reconstituted systems, as differences from the native environment may significantly affect MIP function and regulation.

How do researchers reconcile differences between recombinant MIP functional data and native lens observations?

Reconciling differences between recombinant MIP functional data and native lens observations requires careful consideration of multiple factors:

  • Environmental context differences:

    • Recombinant systems typically use simplified lipid compositions that may not reflect the complex lens fiber cell membrane

    • Native lens has a gradient of lipid compositions (particularly sphingomyelin and cholesterol content) that affects MIP function

    • The cholesterol-to-phospholipid ratio in native lens ranges from 0.6 in cortex to 1.4 in nucleus, compared to 0.3 in Xenopus oocyte expression systems

  • Methodological approaches for reconciliation:

    • Reconstitute recombinant MIP in liposomes with compositions mimicking different lens regions

    • Use native membrane extracts for reconstitution to include minor components

    • Compare functional parameters across multiple experimental systems

    • Develop mathematical models to account for environmental differences

  • Post-translational modifications:

    • Native MIP undergoes age-dependent modifications including truncation, deamidation, and oxidation

    • Recombinant proteins often lack these modifications

    • Researchers can introduce specific modifications to recombinant proteins to assess their impact

  • Protein-protein interactions:

    • In native lens, MIP interacts with cytoskeletal proteins and other membrane components

    • Recent identification of AQP5 in lens fiber cells suggests potential heteromeric interactions

    • Co-expression or co-reconstitution experiments can help address these differences

  • Temporal and spatial considerations:

    • Lens development involves changing MIP expression patterns and environmental contexts

    • Age-related changes alter MIP function in vivo

    • Experiments should specify developmental stage being modeled

When discrepancies are observed, researchers should systematically investigate whether they result from lipid environment differences, post-translational modifications, protein-protein interactions, or technical limitations of the experimental systems.

What analytical techniques help differentiate between MIP water channel activity and adhesion functions?

Differentiating between MIP's water channel activity and adhesion functions requires specialized analytical techniques:

  • Water permeability assays:

    • Stopped-flow light scattering with proteoliposomes

    • Cell swelling/shrinking measurements in transfected cells

    • Comparison with other aquaporins (e.g., AQP1) that lack adhesion function

    • Use of water transport inhibitors (e.g., mercurial compounds) to specifically block channel activity

  • Adhesion measurement techniques:

    • Atomic force microscopy (AFM) to measure adhesive forces between MIP-containing membranes

    • Cell aggregation assays with MIP-expressing cells

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Comparison of wild-type MIP with mutants designed to specifically disrupt adhesion but preserve water channel function

  • Structural analysis approaches:

    • Crystallography or cryo-EM studies of MIP in different conformational states

    • Molecular dynamics simulations to identify domains involved in each function

    • FRET-based assays to detect conformational changes associated with specific functions

    • Site-directed spin labeling and EPR spectroscopy to monitor structural dynamics

  • Comparative data analysis framework:

FunctionKey MeasurementsDistinguishing FeaturesExperimental Controls
Water ChannelOsmotic water permeability (Pf)Temperature-dependent activation energy; pH sensitivity; Mercury inhibitionAQP1 (high permeability) as positive control; Liposomes without protein as negative control
AdhesionCell-cell adhesion force; Junction formationCalcium dependence; Resistance to water channel inhibitors; Involvement of extracellular loopsE-cadherin as positive adhesion control; Other AQPs (e.g., AQP1) as negative controls
  • Mutational analysis strategy:

    • Generate point mutations in specific domains predicted to affect one function but not the other

    • Create chimeric proteins combining domains from MIP with other aquaporins

    • Assess both water permeability and adhesion in each mutant

    • Correlation analysis to determine independence or interdependence of functions

By systematically applying these techniques, researchers can disentangle MIP's dual functions and better understand how each contributes to lens transparency and proper function.

How can researchers effectively use recombinant MIP to investigate lens transparency mechanisms and cataract formation?

Researchers can leverage recombinant MIP to investigate lens transparency mechanisms and cataract formation through several advanced approaches:

  • Structure-function relationship studies:

    • Generate site-specific mutations corresponding to known cataract-causing mutations in humans

    • Perform comparative analysis of water permeability and adhesion properties of wild-type versus mutant proteins

    • Correlate functional deficits with specific structural alterations using crystallography or molecular modeling

    • Investigate how mutations affect MIP's interaction with its lipid environment

  • Reconstitution systems with age-relevant modifications:

    • Create proteoliposomes with lipid compositions mimicking different lens regions and ages

    • Incorporate age-related post-translational modifications to recombinant MIP

    • Compare functionality in "young" versus "aged" membrane environments

    • Assess how oxidative stress affects MIP function in controlled systems

  • Cell-based lens models:

    • Express wild-type or mutant MIP in lens epithelial cells

    • Induce differentiation using FGF-2 to activate natural MIP expression pathways

    • Monitor effects on cell morphology, transparency, and water homeostasis

    • Apply stressors that mimic cataract-inducing conditions to assess MIP's protective role

  • Interaction studies with other lens proteins:

    • Investigate MIP interactions with crystallins, cytoskeletal proteins, and other membrane proteins

    • Assess how these interactions change under cataract-inducing conditions

    • Explore potential protective chaperone interactions that maintain MIP functionality

  • Translational research applications:

    • Use knowledge from recombinant MIP studies to develop targeted therapies for MIP-related cataracts

    • Design screening assays for compounds that stabilize MIP function under stress

    • Develop gene therapy approaches to correct MIP mutations

    • Create diagnostic tools based on MIP structural changes in early cataract formation

These approaches allow researchers to move beyond basic characterization to understand MIP's critical role in maintaining lens transparency and how its dysfunction contributes to cataract formation.

What experimental strategies help elucidate the signaling pathways controlling MIP expression during fiber cell differentiation?

Elucidating the signaling pathways controlling MIP expression during fiber cell differentiation requires comprehensive experimental strategies:

  • Detailed pathway dissection:

    • Investigate FGF signaling components, as FGF-2 has been shown to upregulate MIP expression

    • Apply specific inhibitors to ERK1/2 (UO126) and JNK (SP600125) pathways to confirm their roles

    • Examine crosstalk with other signaling pathways (Wnt, Notch, BMP)

    • Use phospho-specific antibodies to track activation status of pathway components

  • Promoter analysis and transcriptional regulation:

    • Generate reporter constructs with different fragments of the MIP promoter (-1648/+44 has been studied)

    • Perform chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the MIP promoter

    • Conduct EMSA (electrophoretic mobility shift assay) to confirm specific DNA-protein interactions

    • Use CRISPR-Cas9 to modify enhancer regions and assess effects on expression

  • Developmental models with temporal resolution:

    • Use lens explant cultures with timed FGF-2 treatment to track signaling dynamics

    • Implement zebrafish models for in vivo developmental studies

    • Apply single-cell RNA-seq to capture gene expression changes during differentiation

    • Perform lineage tracing to correlate MIP expression with specific differentiation stages

  • Integrative multi-omics approach:

    • Combine transcriptomics, proteomics, and epigenomics data

    • Analyze temporal changes in chromatin accessibility (ATAC-seq)

    • Identify microRNAs that regulate MIP expression

    • Develop computational models of the gene regulatory network

  • Comparative signaling analysis across species:

SpeciesKey Signaling ComponentsMIP Promoter ElementsExperimental Advantages
Mouse/RatERK1/2, JNK activated by FGF-2 -1648/+44 responds to FGF-2 Well-characterized explant systems; Genetic tools available
ZebrafishDevelopmental accessibility Conserved elements identifiedRapid development; In vivo imaging; Genetic manipulation
RabbitFull protein sequence known Less characterizedSimilar to human lens; Commercially available recombinant protein
HumanSimilar to model organisms but with clinical relevanceMutations linked to cataractsPrimary cell availability limited; Disease relevance

By integrating these approaches, researchers can construct a comprehensive understanding of how MIP expression is regulated during lens fiber cell differentiation, providing insights into both normal development and pathological conditions.

What are the common challenges in purifying recombinant MIP protein and how can they be addressed?

Purifying recombinant MIP protein presents several challenges due to its membrane protein nature. Here are common issues and solutions:

  • Low expression yields:

    • Problem: As a membrane protein, MIP often expresses poorly in E. coli systems

    • Solutions:

      • Optimize codon usage for E. coli

      • Use specialized strains (C41/C43, Lemo21)

      • Lower induction temperature (16-20°C)

      • Extend expression time (overnight)

      • Consider fusion partners (MBP, SUMO) to enhance solubility

      • Test insect cell or mammalian expression systems for improved yields

  • Protein misfolding and inclusion body formation:

    • Problem: Overexpression often leads to inclusion bodies with incorrectly folded protein

    • Solutions:

      • Reduce expression rate with lower IPTG concentrations (0.1-0.2 mM)

      • Include chemical chaperones in growth media (glycerol, trehalose)

      • Develop refolding protocols if using inclusion bodies

      • Try cell-free expression systems with supplied detergents

  • Detergent selection challenges:

    • Problem: Inappropriate detergents can destabilize MIP structure and function

    • Solutions:

      • Screen multiple detergents (DDM, OG, LDAO, FC-12)

      • Use mild detergents for extraction (DDM is often effective)

      • Consider detergent exchange during purification

      • Supplement with lipids (especially sphingomyelin) to stabilize protein

  • Protein aggregation during concentration/storage:

    • Problem: Purified MIP tends to aggregate during concentration steps

    • Solutions:

      • Add 6% trehalose to storage buffer

      • Maintain pH at 8.0 for stability

      • Aliquot and flash-freeze immediately after purification

      • Avoid repeated freeze-thaw cycles

      • Consider lyophilization with appropriate cryoprotectants

  • Purity assessment complications:

    • Problem: Standard SDS-PAGE may not accurately represent membrane protein purity

    • Solutions:

      • Use multiple purity assessment methods (SDS-PAGE, size exclusion chromatography)

      • Always confirm identity with Western blotting using specific antibodies

      • Apply mass spectrometry to identify contaminants

      • Assess functional homogeneity through activity assays

How might new structural biology techniques advance our understanding of MIP function and regulation?

Emerging structural biology techniques offer unprecedented opportunities to advance our understanding of MIP function and regulation:

  • Cryo-electron microscopy (Cryo-EM) applications:

    • Single-particle analysis for high-resolution structures of MIP in different conformational states

    • Cryo-electron tomography to visualize MIP arrangement in native lens membranes

    • Time-resolved cryo-EM to capture dynamic structural changes during water transport

    • Advantages over crystallography include capturing MIP in native-like lipid environments and reduced crystal packing artifacts

  • Integrative structural approaches:

    • Combining X-ray crystallography, NMR, and cryo-EM data for complete structural models

    • Integrating mass spectrometry with structural data to map post-translational modifications

    • Correlating structure with function through water permeability measurements

    • Incorporating molecular dynamics simulations to understand water movement through channels

  • Advanced spectroscopic methods:

    • Single-molecule FRET to detect conformational changes in real-time

    • Site-directed spin labeling combined with EPR to probe structural dynamics

    • Solid-state NMR to study MIP structure in membrane environments

    • 2D infrared spectroscopy to examine protein-water interactions at atomic resolution

  • Native mass spectrometry:

    • Analyzing intact membrane protein complexes with associated lipids

    • Identifying specific lipid interactions that modulate MIP function

    • Detecting conformational changes induced by different environments

    • Characterizing age-dependent modifications in native lens MIP

  • In situ structural biology:

    • Cryo-FIB/SEM to prepare lens tissue samples for direct visualization

    • In-cell NMR to study MIP dynamics in living cells

    • Super-resolution microscopy to map MIP distribution and interactions in intact lenses

    • Correlative light and electron microscopy to connect functional and structural observations

These advanced techniques will help resolve several key questions about MIP:

  • How does the lipid environment influence MIP structural dynamics?

  • What structural changes occur during age-related modifications?

  • How do cataract-causing mutations alter MIP structure and function?

  • What is the structural basis for MIP's dual functions as water channel and adhesion molecule?

What are the current knowledge gaps in understanding the relationship between MIP dysfunction and lens pathologies?

Despite decades of research, significant knowledge gaps remain in understanding the relationship between MIP dysfunction and lens pathologies:

  • Mechanistic links between mutations and cataracts:

    • While MIP mutations are associated with congenital cataracts, the precise molecular mechanisms remain unclear

    • Unclear whether water channel dysfunction, adhesion defects, or both contribute to pathology

    • Limited understanding of how different mutations lead to distinct cataract phenotypes

    • Unknown compensatory mechanisms that may delay or modify disease presentation

  • Age-related changes and acquired cataracts:

    • Incomplete understanding of how post-translational modifications affect MIP function during aging

    • Limited data on how changing lipid compositions with age influence MIP water permeability

    • Unclear relationship between oxidative stress, MIP modifications, and cataract formation

    • Insufficient knowledge about potential protective mechanisms against MIP dysfunction

  • Interaction with other lens components:

    • Limited understanding of how MIP interacts with crystallins and other structural proteins

    • Recent discovery of AQP5 in lens fiber cells raises questions about functional interactions between different aquaporins

    • Unclear how cytoskeletal proteins modulate MIP function and distribution

    • Unknown signaling pathways that might regulate MIP function post-transcriptionally

  • Therapeutic intervention points:

    • Lack of pharmacological agents that specifically modulate MIP function

    • Limited understanding of whether restoring MIP function can reverse early cataract formation

    • Insufficient knowledge about whether gene therapy approaches could effectively treat MIP-related cataracts

    • Unknown whether targeting lipid composition could stabilize MIP function during aging

  • Developmental and regional regulation:

    • Incomplete understanding of how MIP expression is regulated during fiber cell differentiation beyond the FGF/ERK/JNK pathway

    • Limited knowledge about regional differences in MIP function across the lens

    • Unknown factors that coordinate MIP expression with other lens proteins

    • Insufficient understanding of species differences in MIP regulation and function

Future research directions should address these knowledge gaps through:

  • Developing better animal models for MIP-related cataracts

  • Applying advanced imaging techniques to study MIP in intact lenses

  • Creating more physiologically relevant in vitro systems

  • Exploring the therapeutic potential of targeting MIP or its regulatory pathways in age-related cataracts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.