Recombinant Rabbit Leukocyte cell-derived chemotaxin 1 (LECT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
CNMD; CHMI; LECT1; Leukocyte cell-derived chemotaxin 1; Chondromodulin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
215-333
Protein Length
Full Length of Mature Protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
CNMD
Target Protein Sequence
EVVRKTVPTTTKRPHSGPRGNPGPARMRNDSRPSVQEDSEPFNPDNPYHQEGESMTFDPR LDHEGICCIECRRSYTHCQKICEPLGGYNPWPYNYQGCRSACRVVMPCSWWVARILGMV
Uniprot No.

Target Background

Function
Recombinant Rabbit Leukocyte cell-derived chemotaxin 1 (LECT1) is a bifunctional growth regulator. It stimulates chondrocyte growth in the presence of basic fibroblast growth factor (FGF), yet inhibits vascular endothelial cell growth. LECT1 may contribute to rapid cartilage growth and vascular invasion preceding cartilage replacement by bone during endochondral ossification. It also inhibits in vitro tube formation and endothelial cell mobilization, acting as an antiangiogenic factor in cardiac valves to suppress neovascularization.
Gene References Into Functions
  1. Chm-1 gene-modified bone marrow mesenchymal stem cells maintain the chondrogenic phenotype of tissue-engineered cartilage, applicable in cartilage tissue engineering. PMID: 27150539
Database Links
Protein Families
Chondromodulin-1 family
Subcellular Location
[Chondromodulin-1]: Secreted, extracellular space, extracellular matrix.; [Chondrosurfactant protein]: Endomembrane system; Single-pass membrane protein.

Q&A

What is Leukocyte Cell-Derived Chemotaxin 1 (LECT1) and what are its primary functions?

LECT1, also known as chondromodulin-1, is a glycosylated transmembrane protein that undergoes cleavage to form a mature, secreted 25 kDa protein. The mature LECT1 protein serves two primary functions: promoting chondrocyte growth and inhibiting angiogenesis. It is predominantly expressed in the avascular zone of prehypertrophic cartilage, with expression decreasing during chondrocyte hypertrophy and vascular invasion . The protein plays a crucial role in endochondral bone development by regulating when cartilaginous anlagen can be vascularized and replaced by bone. Current research also suggests LECT1 may be involved in broader control of tissue vascularization during development .

To study LECT1's functions effectively, researchers should employ both in vitro chondrocyte culture systems and in vivo models of bone development, using techniques such as RNA interference or CRISPR-Cas9 to modulate LECT1 expression levels.

How should researchers design experiments to investigate LECT1's role in angiogenesis inhibition?

When designing experiments to study LECT1's anti-angiogenic properties, researchers should consider a multi-approach experimental design:

  • In vitro endothelial cell assays: Measure endothelial cell proliferation, migration, and tube formation in the presence of purified recombinant LECT1 at varying concentrations (typically 10-500 ng/mL).

  • Ex vivo angiogenesis models: Employ aortic ring assays or chorioallantoic membrane (CAM) assays to evaluate vessel sprouting in response to LECT1.

  • In vivo models: Consider using transgenic mouse models with conditional LECT1 expression or knockout systems.

A robust experimental design should include appropriate controls, dose-response relationships, and time-course analyses . When interpreting results, researchers should be mindful of potentially contradictory data that may emerge from different model systems, as cellular responses to LECT1 may vary depending on the microenvironment and experimental conditions .

What methods are recommended for purifying recombinant rabbit LECT1?

Purification of recombinant rabbit LECT1 requires a systematic approach to ensure protein integrity and activity:

  • Expression system selection: Most researchers use mammalian expression systems (typically HEK293 or CHO cells) for LECT1 expression to ensure proper glycosylation and folding, which are critical for biological activity.

  • Purification strategy: A common purification workflow includes:

    • Initial capture using affinity chromatography (often with a His-tag or GST-tag)

    • Intermediate purification using ion exchange chromatography

    • Polishing step with size exclusion chromatography

  • Quality control assessments:

    • SDS-PAGE to confirm molecular weight (~25 kDa for mature protein)

    • Western blotting with specific antibodies

    • Mass spectrometry for sequence confirmation

    • Activity assays to confirm biological function

Researchers should carefully monitor and control for potential protein aggregation, which can affect LECT1's biological activity in downstream experiments .

How can researchers effectively study the differential roles of precursor versus mature LECT1?

Investigating the differential roles of precursor and mature LECT1 forms requires careful experimental design:

  • Expression constructs: Create expression vectors containing either:

    • Full-length LECT1 cDNA (encoding the precursor)

    • Truncated cDNA encoding only the mature C-terminal region

    • Mutated constructs that prevent proteolytic processing

  • Cell-based assays: Compare the effects of precursor versus mature LECT1 on:

    • Chondrocyte proliferation and differentiation

    • Endothelial cell migration and tube formation

    • Receptor binding and signaling pathway activation

  • Domain-specific antibodies: Develop antibodies that specifically recognize either the N-terminal region (chondrosurfactant protein-like domain) or the C-terminal region (mature LECT1/chondromodulin-1) .

A particularly effective approach is to employ inducible expression systems that allow temporal control over protein expression, enabling researchers to study immediate versus long-term effects of each LECT1 form.

What approaches should be used to address contradictory data in LECT1 research?

When confronting contradictory data in LECT1 research, researchers should implement a systematic approach to resolve discrepancies:

  • Comprehensive literature analysis: Review all published data on LECT1, noting methodological differences that might explain conflicting results.

  • Multi-model validation: Test hypotheses across different:

    • Cell types (primary cells vs. cell lines)

    • Species (rabbit, mouse, human)

    • Experimental conditions (2D culture vs. 3D culture vs. in vivo)

  • Collaborative cross-validation: Partner with other laboratories to independently replicate key findings using standardized protocols.

  • Embrace contradictions as opportunities: As highlighted in modern research methodology, contradictions often lead to the most valuable insights . Rather than dismissing conflicting data, researchers should view these as opportunities to uncover nuanced biological mechanisms.

Researchers should document all experimental variables thoroughly, including cell passage number, culture conditions, reagent sources, and analytical methods, as these factors can significantly influence experimental outcomes and contribute to apparent contradictions.

What experimental design considerations are critical when studying LECT1's interactions with other molecules?

When investigating LECT1's molecular interactions, researchers should consider several key experimental design factors:

  • Protein-protein interaction methods:

    • Co-immunoprecipitation for endogenous interactions

    • Yeast two-hybrid or mammalian two-hybrid for direct interaction screening

    • Surface plasmon resonance (SPR) or bio-layer interferometry for binding kinetics

    • Proximity ligation assays for visualizing interactions in situ

  • Control conditions:

    • Include both positive and negative controls for each interaction assay

    • Use multiple methods to confirm interactions

    • Test interactions under different physiological conditions

  • Domain mapping:

    • Create deletion mutants to identify critical binding regions

    • Use point mutations to validate specific amino acid residues involved in interactions

    • Consider the effects of post-translational modifications on binding

Based on parallels with LECT2 research, investigators should pay particular attention to potential interactions with receptor tyrosine kinases and their downstream signaling pathways .

What are the recommended methods for measuring LECT1 expression and activity in different tissue samples?

To accurately measure LECT1 expression and activity across different tissue samples, researchers should employ multiple complementary approaches:

  • mRNA expression analysis:

    • qRT-PCR for relative quantification of LECT1 transcript levels

    • RNA-seq for comprehensive transcriptomic profiling

    • In situ hybridization for spatial localization in tissue sections

  • Protein detection:

    • Western blotting for semi-quantitative protein analysis

    • ELISA for quantitative measurement in tissue lysates or biological fluids

    • Immunohistochemistry or immunofluorescence for spatial localization

  • Activity assays:

    • Chondrocyte proliferation assays

    • Endothelial cell tube formation inhibition assays

    • Receptor binding and activation assays

TechniqueApplicationSensitivityAdvantagesLimitations
qRT-PCRmRNA quantificationHighFast, quantitativeDoesn't reflect protein levels
Western BlotProtein detectionModerateSize discriminationSemi-quantitative
ELISAProtein quantificationHighHighly quantitativeNo size information
IHC/IFLocalizationModerateSpatial contextAntibody-dependent
Activity AssaysFunctional analysisVariableDirect functional dataComplex interpretation

When comparing LECT1 across different tissues or experimental conditions, researchers should normalize data appropriately and consider the biological context of each sample type .

How should researchers design knockout or knockdown experiments to study LECT1 function?

Designing effective gene manipulation experiments for LECT1 requires careful consideration of several factors:

  • Selection of gene editing approach:

    • siRNA or shRNA for temporary knockdown

    • CRISPR-Cas9 for permanent knockout

    • Conditional systems (e.g., Cre-loxP) for tissue-specific or inducible manipulation

  • Experimental controls:

    • Non-targeting siRNA/shRNA or guide RNA controls

    • Heterozygous knockouts alongside homozygous knockouts

    • Rescue experiments using recombinant LECT1 to confirm specificity

  • Phenotypic analysis:

    • Molecular: Changes in downstream signaling pathways

    • Cellular: Alterations in chondrocyte differentiation or endothelial behavior

    • Tissue: Effects on cartilage development or angiogenesis

    • Organism: Skeletal development in knockout animal models

  • Timing considerations:

    • For developmental studies, consider temporal control of LECT1 depletion

    • For adult tissue studies, assess both acute and chronic effects of LECT1 loss

When implementing these experiments, researchers should verify knockdown/knockout efficiency at both mRNA and protein levels and be alert to potential compensatory mechanisms that may emerge following LECT1 depletion .

What strategies should be employed to overcome technical challenges in recombinant LECT1 production?

Producing high-quality recombinant LECT1 presents several technical challenges that researchers can address through these strategies:

  • Expression system optimization:

    • Test multiple expression systems (bacterial, insect, mammalian)

    • For mammalian expression, compare suspension vs. adherent culture

    • Optimize codon usage for the expression host

    • Consider using secretion signal sequences to enhance protein secretion

  • Protein solubility and stability:

    • Screen various buffer compositions (pH, salt concentration, additives)

    • Test the effect of low concentrations of stabilizing agents (glycerol, trehalose)

    • Evaluate storage conditions (temperature, freeze-thaw cycles)

  • Purification refinement:

    • Optimize tag placement (N-terminal vs. C-terminal)

    • Test different chromatography resins and elution conditions

    • Consider on-column refolding for proteins expressed in inclusion bodies

  • Functional validation:

    • Develop rapid activity assays to assess protein quality during purification

    • Compare activity of different protein batches for consistency

    • Establish quality control benchmarks

When encountering low expression levels, researchers might consider using fusion partners known to enhance expression and solubility, such as SUMO, thioredoxin, or MBP, followed by tag removal using specific proteases .

How should researchers interpret contradictory data regarding LECT1's molecular mechanisms?

When faced with contradictory data about LECT1's molecular mechanisms, researchers should apply these analytical approaches:

  • Context-dependent analysis:

    • Evaluate whether contradictions arise from different cellular contexts or experimental systems

    • Consider that LECT1 may have multiple, context-specific functions

    • Assess whether developmental stage or tissue specificity explains apparent contradictions

  • Integrated data analysis:

    • Combine data from multiple methodologies (genomic, transcriptomic, proteomic)

    • Use pathway analysis tools to understand network-level effects

    • Apply systems biology approaches to model complex interactions

  • Critical evaluation of methodology:

    • Assess the validity and reliability of each experimental approach

    • Consider sensitivity and specificity of detection methods

    • Evaluate statistical power and reproducibility of findings

As highlighted in research methodology literature, embracing contradictions can lead to valuable insights that a simplistic, singular approach might miss . Researchers should view contradictory findings as opportunities to develop more nuanced models of LECT1 function rather than dismissing certain results in favor of others.

What statistical approaches are recommended for analyzing LECT1 expression data across different developmental stages?

Analyzing LECT1 expression across developmental stages requires robust statistical methods:

  • Exploratory data analysis:

    • Visualize expression patterns using heatmaps and PCA plots

    • Assess data distribution and identify potential outliers

    • Evaluate temporal trends using time-course analysis tools

  • Statistical testing:

    • For comparing multiple developmental stages: ANOVA with appropriate post-hoc tests

    • For time-series data: repeated measures ANOVA or mixed-effects models

    • For non-normally distributed data: non-parametric alternatives (Kruskal-Wallis, Friedman)

  • Advanced analytical approaches:

    • Regression analysis to model relationships between LECT1 expression and developmental parameters

    • Machine learning approaches to identify patterns and predictors of expression changes

    • Network analysis to understand co-expression relationships with other genes

Statistical MethodApplicationAdvantagesConsiderations
ANOVAMulti-group comparisonWell-establishedAssumes normality
Repeated Measures ANOVATime-course dataAccounts for within-subject correlationComplete datasets required
Mixed-effects ModelsLongitudinal data with missing valuesRobust to missing dataMore complex interpretation
Non-parametric TestsNon-normal dataNo distributional assumptionsLess statistical power
Regression AnalysisRelationship modelingQuantifies relationshipsRequires assumption checking

Researchers should also consider sample size calculations to ensure adequate statistical power and implement appropriate multiple testing corrections when analyzing expression across numerous developmental timepoints .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.