Recombinant Rabbit Mitochondrial brown fat uncoupling protein 1 (UCP1)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Rabbit UCP1 is a partial-length protein (UniProt ID: P14271) expressed in heterologous systems such as baculovirus or mammalian cells (e.g., HEK293). It retains functional domains necessary for proton transport and nucleotide binding .

Functional Mechanisms

  • Proton Leak Activation: Fatty acids (e.g., palmitate) induce conformational changes, enhancing nucleotide (e.g., GDP) binding and proton conductance .

  • Thermogenesis: Dissipates proton gradient in brown adipose tissue (BAT) mitochondria, converting energy into heat .

  • Reactive Oxygen Species (ROS) Regulation: Reduces superoxide production by uncoupling respiration, mitigating oxidative damage .

Table 1: Key Applications of Recombinant UCP1

ApplicationPurposeSource/Validation
Proton ConductanceStudy fatty acid-driven proton leak in liposome reconstitution assays
Antibody ValidationReference antigen for monoclonal antibodies (e.g., CST #72298, PTGLab)
Gene RegulationInvestigate enhancer-promoter interactions (e.g., Ucp1-En4/En6 regions)
Structural StudiesAnalyze nucleotide-binding kinetics via mant-GDP fluorescence assays

Conformational Dynamics

  • Fatty acids like palmitate alter UCP1’s tertiary structure, increasing mant-GDP binding affinity by ~2-fold in wild-type BAT mitochondria .

  • This conformational shift enables UCP1 to bypass nucleotide inhibition (e.g., GDP), activating proton leak .

Regulatory Mechanisms

  • Enhancer-Promoter Loops: Chromatin interactions (e.g., Ucp1-En4) are essential for cold-induced UCP1 expression, mediated by cohesin subunit RAD21 .

  • Cold Acclimation: Upregulates UCP1 expression by 10–20×, enhancing thermogenic capacity .

Challenges and Considerations

  • Partial Protein Length: Recombinant versions lack full native structure, potentially limiting functional studies .

  • Stability: Requires glycerol (50% final concentration) to prevent aggregation during storage .

  • Species Specificity: Antibodies validated for rabbit UCP1 may show cross-reactivity with mouse or human orthologs .

Future Directions

  • Mechanistic Studies: Resolve controversies over UCP1’s transport mechanism (e.g., fatty acid shuttling vs. conventional carrier exchange) .

  • Therapeutic Potential: Explore UCP1 activation for obesity treatment via BAT-mediated energy dissipation .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are open to fulfilling specific format requests. Please indicate your preferred format in the order notes and we will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
UCP1; SLC25A7; UCP; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MVGTTTTDVPPTMGVKIFSAGVAACLADVITFPLDTAKVRQQIQGEFPITSGIRYKGVLG TITTLAKTEGPLKLYSGLPAGLQRQISFASLRIGLYDTVQEFFTSGEETPSLGSKISAGL TTGGVAVFIGQPTEVVKVRLQAQSHLHGLKPRYTGTYNAYRIIATTESLTSLWKGTTPNL LRNVIINCTELVTYDLMKGALVRNEILADDVPCHFVSALIAGFCTTLLSSPVDVVKTRFI NSPPGQYASVPNCAMTMFTKEGPTAFFKGFVPSFLRLGSWNVIMFVCFEKLKGELMRSRQ TVDCAT
Uniprot No.

Target Background

Function
Mitochondrial brown fat uncoupling protein 1 (UCP1) is a protein crucial for thermogenic respiration, a specialized process occurring in brown adipose tissue and beige fat. It plays a key role in non-shivering adaptive thermogenesis, responding to variations in temperature and diet, as well as broader energy balance regulation. UCP1 functions as a long-chain fatty acid (LCFA) and proton symporter, facilitating simultaneous transport of one LCFA and one proton across the inner mitochondrial membrane. However, the LCFAs remain associated with the transporter via their hydrophobic tails, leading to apparent proton transport activated by LCFAs. This process dissipates the mitochondrial proton gradient, converting the energy from substrate oxidation into heat instead of ATP. UCP1 also regulates the production of reactive oxygen species (ROS) within mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Brown adipose tissue.

Q&A

What is the molecular weight and basic structure of UCP1?

UCP1 is a mitochondrial protein with a molecular weight of approximately 30 kDa as determined by Western blot analysis . Located in the inner mitochondrial membrane, UCP1 functions as a proton transporter that dissipates the electrochemical gradient generated by the respiratory chain. This uncoupling of oxidative phosphorylation results in heat production instead of ATP synthesis, which is the molecular basis of non-shivering thermogenesis.

The protein exhibits tissue-specific expression, being predominantly found in brown adipose tissue and beige adipocytes. The basic structure of UCP1 allows it to interact with both fatty acids and nucleotides, which serve as key regulators of its activity. Researchers should note that recombinant UCP1 should maintain the same molecular weight and structural properties as the native protein when properly expressed and purified.

How does UCP1 function in brown adipose tissue thermogenesis?

UCP1 mediates thermogenesis in brown adipose tissue through its unique transport mechanism. Classic studies established that UCP1-dependent thermogenesis is activated by long-chain fatty acids and involves proton transport across the inner mitochondrial membrane . Recent research using the patch-clamp technique has revealed that UCP1 operates as an unusual fatty acid anion (FA−)/H+ symporter .

In this mechanism, fatty acid anions activate UCP1 by serving as transport substrates. Importantly, long-chain fatty acids cannot dissociate from UCP1 due to strong hydrophobic interactions established by their carbon tails, thus serving as continuously attached substrates . This mechanism allows UCP1 to efficiently dissipate the proton gradient, generating heat instead of ATP.

The thermogenic pathway is triggered by norepinephrine released from sympathetic nerves in response to cold exposure or β-adrenergic agonists. This activates lipolysis in brown adipocytes, releasing fatty acids that both fuel mitochondrial respiration and activate UCP1, creating a coordinated response to thermogenic stimuli.

What are the differences in UCP1 expression between different adipose tissue depots?

UCP1 expression varies significantly across different adipose tissue depots:

In interscapular brown adipose tissue (iBAT), UCP1 is abundantly expressed as this represents classic brown fat . Following β-adrenergic stimulation with CL-316,243 (CL), virtually all cells in the inguinal (subcutaneous) adipose depot become UCP1-positive, indicating a homogeneous response to browning stimuli .

In contrast, the epididymal (visceral) adipose tissue shows a heterogeneous response to browning stimuli, with two distinct populations of beige adipocytes:

  • UCP1-positive beige adipocytes organized in discrete clusters

  • UCP1-negative beige adipocytes that still display multilocularity and increased mitochondrial content

Immunohistochemical analyses confirm that CL treatment produces isolated islands of UCP1-positive adipocytes in epididymal fat, while the majority of mitochondria-rich beige adipocytes remain UCP1-negative . This heterogeneity has important implications for experimental design when studying beige adipocyte thermogenesis.

Interestingly, the clustered arrangement of UCP1-positive cells in epididymal fat suggests they likely originate from specific precursor cells rather than through white adipocyte interconversion .

How do fatty acids interact with UCP1 to regulate its activity?

Fatty acids play a crucial role in regulating UCP1 activity through multiple mechanisms:

  • Conformational change induction: Fatty acids, particularly palmitate, dramatically change the binding kinetics of nucleotides to UCP1, indicating they induce a significant conformational change in the protein . This was demonstrated using fluorescent nucleotide analog (mant-GDP) binding assays, where palmitate substantially altered binding parameters.

  • Transport substrate function: Fatty acid anions (FA−) activate UCP1 by serving as transport substrates. UCP1 operates as an FA−/H+ symporter, with long-chain fatty acids remaining continuously attached to UCP1 due to strong hydrophobic interactions .

  • Competitive inhibition reversal: Fatty acids can competitively reverse the inhibitory effect of purine nucleotides like GDP on UCP1. This competitive interaction represents a key regulatory mechanism for UCP1 function .

The specificity of fatty acid interactions with UCP1 is also important. Short-chain fatty acids can dissociate from UCP1, while long-chain fatty acids remain attached and serve as permanent transport substrates . This mechanistic understanding is essential for designing experiments that accurately measure UCP1 activity in various contexts.

What techniques are most effective for measuring UCP1-dependent proton transport?

Several complementary techniques can effectively measure UCP1-dependent proton transport:

  • Mitochondrial patch-clamp technique: This direct approach involves recording UCP1 currents across the whole inner mitochondrial membrane of mitoplasts (mitochondria with the outer membrane removed) . This technique provided the first direct evidence that UCP1 operates as an FA−/H+ symporter and revealed the continuous attachment of long-chain fatty acids to UCP1 .

Protocol highlights:

  • Isolate mitochondria from brown or beige adipose tissue

  • Generate mitoplasts through osmotic swelling

  • Form gigaohm seals between the patch pipette and inner mitochondrial membrane

  • Record currents under various conditions (±fatty acids, ±GDP)

  • Fluorescent nucleotide binding assays: Using fluorescent nucleotide analogs like mant-GDP allows researchers to monitor conformational changes in UCP1 and the effects of various modulators . This approach demonstrated that palmitate dramatically changes UCP1 conformation, affecting nucleotide binding kinetics.

  • Membrane potential measurements: Fluorescent dyes can monitor mitochondrial membrane potential dissipation as a measure of UCP1 activity. The UCP1-dependent component can be isolated by using GDP to inhibit UCP1 or comparing wild-type versus UCP1−/− mitochondria.

For all these techniques, proper controls (UCP1−/− samples, GDP inhibition) are essential to isolate the UCP1-specific component of the measured signals.

How is UCP1 expression regulated at the genomic level?

UCP1 expression is regulated through complex genomic mechanisms involving enhancer-promoter interactions:

Recent research using circularized chromosome conformation capture coupled with next-generation sequencing (4C-seq) has revealed the chromatin interaction landscape of the UCP1 gene . This work identified four interscapular brown adipose tissue (iBAT)-specific active enhancers of UCP1, with three of them activated by cold stimulation .

Functional studies demonstrated that:

  • Transcriptional repression of specific enhancer regions (Ucp1-En4 or Ucp1-En6) significantly downregulates UCP1 expression and impairs mitochondrial function in brown adipocytes .

  • The cohesin subunit RAD21 plays a crucial role in maintaining the interaction between Ucp1-En4 and the UCP1 promoter. Depletion of RAD21 decreases this interaction and downregulates UCP1 .

  • The transcription factor EBF2 cooperates with the acetyltransferase CBP to regulate Ucp1-En4 activity and increase UCP1 transcriptional activity .

In vivo experiments with lentivirus-mediated repression of Ucp1-En4 resulted in impaired iBAT thermogenic capacity and mitochondrial function under cold acclimation conditions . These findings provide crucial insights into the tissue-specific regulation of UCP1 expression and potential therapeutic targets.

What is the relationship between UCP1 expression and mitochondrial biogenesis?

The relationship between UCP1 expression and mitochondrial biogenesis reveals interesting complexities:

  • Coordinated induction: Cold exposure or β-adrenergic stimulation typically induces both UCP1 expression and mitochondrial biogenesis, evidenced by increased expression of markers like PGC1α, COX IV, and TOM20 .

  • UCP1-independent mitochondrial biogenesis: Remarkably, UCP1 is not essential for mitochondrial biogenesis during browning. In UCP1−/− mice, robust mitochondrial biogenesis occurs in both epididymal and inguinal adipose tissues following β-adrenergic stimulation, as demonstrated by increased expression of PGC1α, COX IV and TOM20 .

  • Tissue-specific responses: CL injection (a β3-adrenergic agonist) does not induce mitochondrial biogenesis in interscapular brown fat of either wild-type or UCP1−/− mice, while it strongly promotes mitochondrial biogenesis in white fat depots . This highlights the differential regulation of mitochondrial content across adipose tissues.

  • Mitochondrial morphology: Mitochondrial size can indicate thermogenic capacity, with brown adipocyte mitochondria typically being fragmented and round, especially upon norepinephrine stimulation. Interestingly, the average mitochondrial size in UCP1-negative and UCP1-positive epididymal beige adipocytes is similar, suggesting morphological and functional similarity despite differences in UCP1 expression .

These findings demonstrate that while UCP1 expression and mitochondrial biogenesis often occur together, they can be mechanistically uncoupled in certain contexts, which has important implications for interpreting data related to adipose tissue browning.

How does UCP1 expression correlate with metabolic parameters in humans?

Human studies have revealed significant correlations between UCP1 expression in brown adipose tissue and various metabolic parameters:

A recent study analyzing human brown adipose tissue showed that UCP1 expression is inversely associated with cardiometabolic risk factors . The research dichotomized subjects into "high UCP1" (n=17) and "low UCP1" (n=36) groups, using a UCP1 threshold of 2 arbitrary units (AU).

Key findings included:

  • The high UCP1 group was characterized by:

    • Younger age

    • Lower BMI

    • Lower waist and hip circumference

    • Lower waist-hip ratio (WHR) and waist-height ratio

    • Lower fat mass and fat percentage

  • The proportion of individuals with high UCP1 expression progressively declined with increasing age and BMI .

  • UCP1 expression showed a trimodal distribution:

    • Lower tertile: median 0.002 arbitrary units (AU)

    • Middle tertile: median 0.06 AU

    • Upper tertile: median 7.2 AU

What are the differences between UCP1-positive and UCP1-negative beige adipocytes?

The discovery of UCP1-negative beige adipocytes has revealed previously unrecognized heterogeneity in adipose tissue:

  • Spatial distribution: UCP1-positive beige adipocytes in epididymal fat are organized in discrete clusters, suggesting they originate from specific precursor cells rather than through white adipocyte interconversion . In contrast, UCP1-negative beige adipocytes are more widely distributed throughout the tissue.

  • Shared beige characteristics: Despite lacking UCP1, UCP1-negative beige adipocytes still display key features of the beige phenotype:

    • Multilocularity (multiple small lipid droplets)

    • Increased mitochondrial content (evidenced by OXPHOS immunostaining)

    • Similar mitochondrial size to UCP1-positive beige adipocytes

  • Response to stimuli: Both UCP1-positive and UCP1-negative beige adipocytes respond to β-adrenergic stimulation with increased mitochondrial biogenesis, but only the former upregulate UCP1 expression .

  • Thermogenic mechanisms: UCP1-negative beige adipocytes likely employ alternative thermogenic mechanisms, potentially including:

    • Other uncoupling proteins (UCP2, UCP3)

    • Calcium cycling through SERCA

    • Creatine substrate cycling

    • Futile cycling of fatty acids

This heterogeneity has important methodological implications. Researchers studying beige adipocytes should not rely solely on UCP1 expression as a marker for browning, as this would miss the UCP1-negative population. Additional markers of the beige phenotype, such as mitochondrial content and multilocularity, should be assessed alongside UCP1 expression.

What are the optimal antibodies and methods for detecting UCP1 in different experimental contexts?

For reliable detection of UCP1 across different experimental contexts, researchers should consider the following methodological approaches:

  • Western blotting:

    • Recommended antibody: UCP1 (E9Z2V) XP® Rabbit mAb #72298 has demonstrated high specificity for mouse and rat UCP1

    • Working dilution: 1:1000

    • Expected molecular weight: 30 kDa

    • Important considerations: Include positive controls (BAT extracts) and negative controls (white adipose tissue from UCP1−/− mice)

  • Immunohistochemistry (paraffin sections):

    • Recommended antibody: UCP1 (E9Z2V) XP® Rabbit mAb #72298

    • Working dilution: 1:50

    • Protocol notes: Heat-mediated antigen retrieval is typically required

  • Immunofluorescence (frozen sections):

    • Recommended antibody: UCP1 (E9Z2V) XP® Rabbit mAb #72298

    • Working dilution: 1:50 - 1:100

    • Co-staining recommendations: Combine with mitochondrial markers (TOM20, COX IV) to assess colocalization

  • Quantitative PCR:

    • Target: UCP1 mRNA

    • Important controls:

      • Measure reference genes stable across adipose tissue types

      • Include both positive (BAT) and negative (WAT from UCP1−/− mice) controls

  • Validation strategies:

    • Compare results across multiple detection methods

    • Confirm antibody specificity using UCP1−/− tissues

    • Verify that the antibody does not cross-react with UCP2 or UCP3

For all methods, researchers should be aware of potential false positives in white adipose tissue and consider using UCP1−/− controls whenever possible to confirm specificity. Additionally, for studies in beige adipocytes, it's important to remember that not all beige adipocytes express UCP1, particularly in epididymal fat .

How can UCP1 conformational changes be experimentally measured?

UCP1 undergoes significant conformational changes in response to its regulators, particularly fatty acids. These conformational changes can be measured using several complementary approaches:

  • Nucleotide binding assays: Fluorescent nucleotide analogs like mant-GDP provide a powerful tool for monitoring UCP1 conformational changes . Key experimental findings include:

    • Palmitate dramatically changes the binding kinetics of mant-GDP to UCP1, indicating a conformational change

    • This effect is UCP1-specific, as it is almost entirely absent in mitochondria from UCP1-null mice

    • Control experiments with dimethyl anthranilate (which lacks the GDP moiety) confirm that binding is mediated through the nucleotide rather than the fluorescent tag

Experimental protocol highlights:

  • Isolate mitochondria from brown adipose tissue

  • Incubate with mant-GDP in the presence or absence of palmitate

  • Measure specific binding through fluorescence enhancement

  • Use UCP1−/− mitochondria as controls to confirm specificity

  • Proteolytic footprinting: Limited proteolysis can identify regions of UCP1 that become more exposed or protected upon fatty acid binding, providing structural insights into the conformational changes.

  • Spectroscopic techniques: Intrinsic fluorescence, circular dichroism, or FTIR spectroscopy can detect global conformational changes in purified UCP1 upon ligand binding.

These approaches have revealed that fatty acids induce substantial conformational changes in UCP1, which likely underlie the mechanism by which they activate UCP1-dependent proton transport and thermogenesis.

What experimental design considerations are essential when studying UCP1 function in different adipose tissue depots?

When studying UCP1 function across different adipose tissue depots, researchers should consider these critical experimental design factors:

  • Depot-specific UCP1 expression patterns:

    • All inguinal beige adipocytes become UCP1-positive after β-adrenergic stimulation

    • Epididymal beige adipocytes show heterogeneous UCP1 expression, with distinct UCP1-positive and UCP1-negative populations

    • These differences necessitate depot-specific sampling and analysis strategies

  • Tissue collection and processing:

    • Standardize cold exposure or β-adrenergic stimulation protocols

    • Consider timing of tissue collection (acute vs. chronic stimulation)

    • Use consistent anatomical landmarks for depot identification

    • Process tissues rapidly to preserve UCP1 and mitochondrial integrity

  • Comprehensive phenotyping:

    • Assess both UCP1 expression and mitochondrial content

    • Evaluate multilocularity through histological analysis

    • Include functional measurements (oxygen consumption, thermogenesis)

    • Consider UCP1-independent thermogenic mechanisms, especially in epididymal fat

  • Appropriate controls:

    • Include both positive (interscapular BAT) and negative (WAT from UCP1−/− mice) controls

    • Consider age, sex, and strain-matched controls

    • For beige adipocyte studies, compare effects in multiple depots (inguinal vs. epididymal)

  • Isolation of adipocytes vs. whole tissue analysis:

    • For electrophysiological studies of UCP1 function in beige adipocytes, inguinal fat is preferable due to the higher abundance of UCP1-positive cells

    • For studies of UCP1-negative beige adipocytes, epididymal fat provides a rich source

    • When isolating mitochondria from beige adipocytes, consider the heterogeneity in UCP1 expression

These considerations are essential for generating reproducible and physiologically relevant data on UCP1 function across different adipose tissue depots.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.