Recombinant Rabbit NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant rabbit MT-ND3 exhibits several distinct biochemical properties that are relevant to its function and laboratory handling. The protein has a calculated molecular weight of approximately 13 kDa, which has been confirmed through SDS-PAGE analysis . The recombinant protein is typically produced in E. coli expression systems, which allow for consistent production of high-quality protein suitable for various experimental applications .

Expression Systems

The primary expression system for recombinant rabbit MT-ND3 is Escherichia coli, which provides several advantages for protein production. E. coli offers rapid growth, high protein yields, and cost-effective production protocols . The recombinant protein is engineered with an N-terminal histidine tag, which facilitates efficient purification through affinity chromatography techniques. This approach ensures high purity, with products typically achieving greater than 90% purity as determined by SDS-PAGE analysis .

Role in Mitochondrial Respiration

MT-ND3 serves as an integral component of Complex I, which represents the largest of the five respiratory complexes in the mitochondrial electron transport chain. This complex catalyzes the critical first step of the electron transport process—the transfer of electrons from NADH to ubiquinone . This electron transfer is coupled to proton translocation across the inner mitochondrial membrane, contributing to the establishment of the proton gradient that drives ATP synthesis.

As a core subunit of Complex I, MT-ND3 is directly involved in maintaining the structural integrity and functional capacity of this large multi-subunit enzyme complex. The hydrophobic nature of MT-ND3 allows it to reside within the membrane domain of Complex I, where it contributes to the proton-pumping mechanism essential for energy production .

Pathophysiological Implications

Mutations in the MT-ND3 gene have been associated with several mitochondrial disorders, highlighting the critical nature of this protein in cellular function. Pathogenic variants of MT-ND3 can cause mitochondrial complex I deficiency (MT-C1D), which may manifest as a range of clinical disorders including Leigh syndrome, Leber hereditary optic neuropathy, and various forms of encephalopathy . These conditions typically result from compromised energy production in tissues with high metabolic demands, such as the brain, heart, and skeletal muscle.

The availability of recombinant rabbit MT-ND3 provides researchers with a valuable tool for investigating the molecular mechanisms underlying these disorders and potentially developing therapeutic strategies.

Antibodies for MT-ND3 Detection

Several antibodies have been developed for the detection and study of MT-ND3, each offering specific advantages for different experimental applications. These include both polyclonal and monoclonal antibodies with varying specificities and applications . Table 2 summarizes the key features of available MT-ND3 antibodies:

Table 2: Antibodies for MT-ND3 Detection and Analysis

TypeHostReactivityApplicationsDilution RangeKey Features
PolyclonalRabbitHumanWB, ELISA1:500 - 1:2000Targets N-terminal region
PolyclonalRabbitHuman, Mouse, RatWB, ELISA1:500 - 1:2000Recognizes sequence within amino acids 1-100
Monoclonal (E8O4E)RabbitHumanWB, IP1:1000 (WB), 1:200 (IP)Targets C-terminus region, high specificity
PolyclonalRabbitHumanWB1:1000Targets C-terminus region

These antibodies enable researchers to detect MT-ND3 in various experimental settings, facilitating studies on protein expression, localization, and interactions.

ELISA Kits for Quantitative Analysis

Enzyme-linked immunosorbent assay (ELISA) kits have been developed for the quantitative analysis of MT-ND3 in biological samples. These kits offer a sensitive and specific method for measuring MT-ND3 levels in research contexts . Available ELISA kits for MTND3 detection include:

  • Mouse NADH-Ubiquinone Oxidoreductase Chain 3 (MTND3) ELISA Kit with detection range 0.156 ng/ml - 10 ng/ml

  • Rat NADH-Ubiquinone Oxidoreductase Chain 3 (MTND3) ELISA Kit with detection range 0.156 ng/ml - 10 ng/ml

These tools provide researchers with the ability to quantitatively assess MT-ND3 levels in different experimental conditions, potentially offering insights into its regulation and function.

Protein Functionality Assays

Recombinant rabbit MT-ND3 can be utilized in various functional assays to investigate its role in mitochondrial function. These may include:

  1. Complex I activity assays to assess the contribution of MT-ND3 to electron transport

  2. Protein-protein interaction studies to identify binding partners and regulatory mechanisms

  3. Reconstitution experiments in membrane systems to evaluate its role in proton translocation

For optimal results in such assays, the protein should be handled according to the previously described storage and reconstitution guidelines .

Comparative Analysis with Other Species

While this article focuses specifically on recombinant rabbit MT-ND3, it is worth noting that MT-ND3 is highly conserved across mammalian species. The rabbit (Oryctolagus cuniculus) MT-ND3 shares significant sequence homology with human, mouse, and rat orthologs . This conservation reflects the critical nature of this protein in mitochondrial function across species.

The availability of recombinant MT-ND3 from different species enables comparative studies that can identify both conserved functional domains and species-specific variations. Such analyses may provide insights into the evolutionary adaptation of mitochondrial function across different taxonomic groups.

Therapeutic Potential

Given the association of MT-ND3 mutations with various mitochondrial disorders, future research may focus on developing therapeutic approaches targeting this protein or compensating for its dysfunction. Recombinant rabbit MT-ND3 provides a valuable tool for screening potential therapeutic compounds and understanding their mechanisms of action.

Systems Biology Integration

Integrating MT-ND3 research into broader systems biology approaches may offer comprehensive insights into mitochondrial function and regulation. This may involve:

  1. Multi-omics studies combining proteomics, metabolomics, and transcriptomics data

  2. Computational modeling of Complex I assembly and function

  3. Investigation of mitochondrial dynamics and quality control mechanisms

Such integrated approaches can position MT-ND3 within the complex regulatory networks that govern mitochondrial function and cellular energy production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MNLMLVLLINTTISLVLVTIAFWLPQLNIYSEKSSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAAQFNNLNLVLIMALMLISILALGLAYEWIQKGLEWVE
Uniprot No.

Target Background

Function

Function: Recombinant Rabbit NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor. MT-ND3 is essential for the catalytic activity of Complex I.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-ND3 in mitochondrial respiratory chain Complex I?

MT-ND3 serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It is believed to belong to the minimal assembly required for catalysis . As part of the large multi-subunit Complex I, MT-ND3 assists in proton translocation across the mitochondrial membrane, which is indispensable for generating an electrochemical gradient used in ATP synthesis .

The protein is essential for the catalytic activity of complex I and plays a direct role in the enzyme's function rather than merely serving as a structural component . The immediate electron acceptor for the enzyme is believed to be ubiquinone, making MT-ND3 integral to the efficient functioning of the electron transport system .

How is MT-ND3 encoded and what is its structure?

MT-ND3 is encoded by mitochondrial DNA (mtDNA) rather than nuclear DNA, making it one of the seven mitochondrially-encoded subunits of Complex I . The full-length protein typically consists of approximately 115 amino acids, as seen in the Elephas maximus (Indian elephant) ortholog . The amino acid sequence is highly conserved across species, reflecting its essential function.

The protein structure includes transmembrane domains that anchor it within the inner mitochondrial membrane, allowing it to participate in the proton pumping mechanism of Complex I. MT-ND3's placement within the P module (proton pump module) of Complex I is crucial for its function in the bioenergetic processes of the mitochondria .

What methods are commonly used to measure MT-ND3 activity in research?

Several approaches are used to measure MT-ND3 activity as part of Complex I:

NADH:ubiquinone oxidoreductase activity assay:
This spectrophotometric method directly measures Complex I activity by monitoring NADH consumption in the presence of ubiquinone. The protocol typically involves:

  • Preparation of mitochondrial extracts through freeze-thawing cycles

  • Reaction in buffer containing potassium phosphate (pH 7.5), BSA, KCN, and NADH

  • Initiation with ubiquinone and monitoring absorbance at 340 nm

  • Addition of rotenone (Complex I inhibitor) to discount CI-independent activity

  • Calculation using the NADH extinction coefficient (6.2 mM⁻¹ cm⁻¹)

ELISA-based detection:
Sandwich ELISA methods employ:

  • Microplates pre-coated with MT-ND3-specific antibodies

  • Sample addition to allow MT-ND3 binding

  • Addition of biotin-conjugated antibodies specific for MT-ND3

  • Addition of Streptavidin-HRP conjugate

  • Development with substrate solution and colorimetric measurement

Immunological detection:
Immunohistochemistry and immunofluorescence using specific antibodies can localize MT-ND3 in tissues and cells, with standard protocols involving:

  • Fixation with PFA for tissue samples

  • Permeabilization with Triton X-100 for cell samples

  • Incubation with primary antibodies at appropriate dilutions (e.g., 1/20 for IHC or 4 μg/mL for IF)

  • Detection with appropriate secondary antibodies and visualization systems

How do mutations in MT-ND3 manifest clinically?

Mutations in MT-ND3 have been associated with several clinical presentations:

  • Sensorimotor axonal polyneuropathy: A novel MT-ND3 mutation (m.10372A>G) has been reported in a patient with adult-onset sensorimotor axonal polyneuropathy. Clinical findings included:

    • Ragged red fibers in muscle tissue

    • Paracrystalline inclusions

    • Significant reduction in Complex I respiratory chain activity

    • Decreased ATP production for all substrates used by Complex I

  • Leigh syndrome: MT-ND3 mutations, such as m.10134C>A (p.Gln26Lys), have been identified in patients with Leigh syndrome, a severe neurological disorder .

  • Heteroplasmy considerations: The severity of these conditions often correlates with the level of heteroplasmy (percentage of mutated mtDNA) in affected tissues. Interestingly, some tissues may lose heteroplasmy while others maintain it, as seen in a case where cultured myoblasts did not carry the mutation while skeletal muscle did .

How can heteroplasmy of MT-ND3 mutations be accurately quantified?

Accurate quantification of heteroplasmy in MT-ND3 mutations is critical for determining pathogenicity and disease progression. Several methods can be employed:

qPCR-based quantification:

  • Design PCR primers specific to both mutant and wild-type MT-ND3 sequences

  • Generate standard curves using ten-fold dilutions of mutant and wild-type amplicons inserted into vectors

  • Perform quantitative PCR using SYBR green with optimized conditions:

    • Typical conditions: 95°C for 12 minutes, followed by 35 cycles of (95°C for 10s, 66°C for 15s, 72°C for 10s)

    • Include additives to improve specificity: 1.5 mM MgCl₂, 2% DMSO, 1M betaine

  • Calculate mutant load by comparing amplification against standard curves

Last-cycle hot PCR:
This method provides precise quantification of mutant mtDNA in different tissues and can detect low-level heteroplasmy with greater sensitivity than conventional qPCR .

ARMS-PCR (Amplification Refractory Mutation System):
This method enables quantitative determination of mutation rates in mRNA:

  • Extract mitochondria and treat with RNase to remove RNA absorbed to the surface

  • Extract total RNAs from isolated mitochondria

  • Prepare cDNA using reverse transcription

  • Perform ARMS-PCR using carefully designed primers for wild-type and mutant sequences

  • Calculate mutation rate using standard curves generated from known mixtures of wild-type and mutant plasmids

When designing primer sets, it's essential to validate them using mixed plasmid templates containing both wild-type and mutant sequences at various ratios (0-100%) to ensure accurate quantification.

What are the challenges in expressing and purifying recombinant MT-ND3?

Expressing and purifying recombinant MT-ND3 presents several challenges for researchers:

Expression system selection:

  • E. coli expression: While E. coli systems are commonly used for recombinant protein expression, hydrophobic membrane proteins like MT-ND3 often form inclusion bodies, requiring optimization:

    • Use of specialized E. coli strains (e.g., C41(DE3), C43(DE3)) designed for membrane protein expression

    • Lowering induction temperature (16-20°C) to slow protein synthesis

    • Using mild detergents for extraction and purification

  • Eukaryotic expression systems: May provide better folding but with lower yields:

    • Insect cell systems (baculovirus)

    • Mammalian cell expression for proper post-translational modifications

Purification considerations:

  • Tag selection: His-tags are commonly used, but position (N-terminal vs. C-terminal) can affect functionality and solubility

  • Buffer optimization: Critical for stability:

    • Tris/PBS-based buffers with stabilizing agents (e.g., 6% Trehalose, pH 8.0)

    • Addition of glycerol (5-50%) for long-term storage

  • Storage concerns: Repeated freeze-thaw cycles should be avoided; aliquoting and storage at -20°C/-80°C is recommended

Functional validation:
After purification, functionality assessment is crucial through:

  • Reconstitution into liposomes or nanodiscs to mimic native membrane environment

  • Activity assays to confirm electron transfer capability

  • Structural integrity verification via circular dichroism or limited proteolysis

How can researchers distinguish between pathogenic and non-pathogenic MT-ND3 variants?

Distinguishing pathogenic from non-pathogenic MT-ND3 variants requires multiple lines of evidence:

Biochemical approaches:

  • Respiratory chain enzyme activity measurements:

    • Spectrophotometric assays of Complex I activity in patient-derived tissues

    • Comparison against control samples to establish significant reduction in activity

    • Measurement of ATP production with Complex I-specific substrates

  • Heteroplasmy analysis:

    • Quantification of mutant load across multiple tissues

    • Correlation of heteroplasmy levels with clinical and biochemical phenotypes

    • Loss of heteroplasmy in certain tissues (e.g., blood, cultured fibroblasts) with retention in affected tissues supports pathogenicity

Genetic and bioinformatic methods:

  • Whole genome sequencing (WGS) to confirm the variant and exclude other genetic causes

  • Alignment tools using Burrows-Wheeler alignment (BWA)

  • Variant processing with tools like:

    • Picard v1.8

    • SAMtools

    • Genome Analysis Toolkit (GATK)

  • Variant annotation using databases like:

    • dbSNP

    • 1000 genomes

    • NHLBI exome project

Functional validation:

  • Cybrid studies: Transfer of patient mitochondria to ρ⁰ cells (cells lacking mtDNA) to assess variant impact in controlled nuclear background

  • Model systems: Recapitulation of mutations in model organisms or cell lines using CRISPR-based mitochondrial editing

  • Structural modeling: Assessment of amino acid changes on protein structure and function

What experimental approaches are effective for studying MT-ND3 interactions within Complex I?

Studying MT-ND3 interactions within the larger Complex I structure requires sophisticated approaches:

Crosslinking coupled with mass spectrometry:

  • Chemical crosslinking of neighboring subunits using membrane-permeable reagents

  • Digestion of crosslinked complexes with trypsin

  • Identification of crosslinked peptides by electrospray mass spectrometry

  • Mapping of interaction sites based on identified peptide pairs

Blue native polyacrylamide gel electrophoresis (BN-PAGE):

  • Isolation of mitochondria from relevant tissues

  • Solubilization with mild detergents (digitonin or n-dodecyl β-D-maltoside)

  • Separation of intact complexes on native gels

  • Second dimension SDS-PAGE for subunit analysis

  • Western blotting with MT-ND3 specific antibodies to detect assembly intermediates

Cryo-electron microscopy:
Recent advances in cryo-EM have revolutionized the structural biology of membrane protein complexes:

  • Purification of intact Complex I under mild conditions

  • Sample preparation on cryo-EM grids

  • Image acquisition and processing

  • Generation of 3D reconstructions to visualize MT-ND3 within the complex architecture

Mutagenesis studies:

  • Introduction of specific mutations in MT-ND3

  • Assessment of Complex I assembly, stability, and function

  • Correlation of functional impact with structural location of mutations

What is the role of MT-ND3 in pathogen-host interactions during viral infections?

Recent research has revealed interesting connections between MT-ND3/Complex I and viral infections:

Dengue virus interactions:
The Dengue virus non-structural protein 3 (NS3) has been shown to impair Complex I activity in a protease-dependent manner:

This interaction represents a novel mechanism by which viruses can modulate host cell metabolism to create a favorable environment for viral replication and may suggest new therapeutic targets for treating viral infections.

What therapeutic strategies target MT-ND3 dysfunction in mitochondrial disorders?

Several therapeutic approaches are being developed to address MT-ND3 dysfunction:

RNA-based therapeutic strategies:
Researchers have validated mitochondrial gene therapeutic strategies using fibroblasts from a Leigh syndrome patient:

  • Delivery of therapeutic RNA molecules to mitochondria using specialized delivery systems (MITO-Porters)

  • Processing of cells to evaluate therapeutic efficacy:

    • Washing cells with CellScrub buffer to remove surface-bound delivery vehicles

    • Homogenization and isolation of mitochondria

    • RNase treatment to remove RNA absorbed to mitochondrial surfaces

    • RNA extraction and cDNA preparation

    • Quantification of mutation rates using ARMS-PCR

EPI-743 clinical trials:
EPI-743, a para-benzoquinone analog that targets NADH:quinone oxidoreductase 1 (NQO1), has shown promise in treating Complex I deficiencies:

  • Phase 2B clinical trials have included patients with MT-ND3 mutations

  • The compound aims to restore redox balance in cells with dysfunctional Complex I

  • Genetic identification of specific MT-ND3 mutations (e.g., m.10134C>A) has facilitated patient inclusion in these trials

Mitochondrial replacement therapy:
For inherited MT-ND3 mutations, mitochondrial replacement techniques are being developed that replace mutated mtDNA with donor mitochondria containing wild-type mtDNA.

Small molecule approaches:
Screening efforts have identified compounds that can bypass or enhance Complex I function:

  • Idebenone and CoQ10 analogs that can accept electrons from NADH and transfer them to Complex III

  • Compounds that stabilize Complex I assembly or enhance its activity

  • Molecules that increase mitochondrial biogenesis to compensate for reduced Complex I function

These therapeutic strategies represent promising avenues for addressing the significant clinical challenges posed by MT-ND3 mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.