Recombinant Rabbit Potassium voltage-gated channel subfamily A member 5 (KCNA5)

Shipped with Ice Packs
In Stock

Description

Functional Roles

KCNA5 mediates the ultrarapid delayed rectifier potassium current (IKur_{Kur}), influencing:

  • Cardiac Action Potential Repolarization: Shortens atrial action potential duration; loss-of-function mutations prolong QT intervals .

  • Vascular Tone Regulation: Modulates pulmonary artery smooth muscle contraction under hypoxia .

  • Neuromodulation: Affects microglial proliferation and nitric oxide release in the CNS .

Key Functional Mutations

  • G182R/E211D: Accelerates inactivation kinetics and reduces surface expression .

  • Y155C/D469E/P488S: Loss-of-function variants linked to familial atrial fibrillation .

Research Applications

Recombinant KCNA5 is widely used in:

  • Electrophysiological Studies: Heterologous expression in HEK293 or L cells to characterize current kinetics .

  • Antibody Development: Polyclonal antibodies (e.g., Anti-Kv1.5) validate channel localization in cardiac and vascular tissues .

  • Drug Screening: Testing 4-aminopyridine (4-AP) and other blockers targeting atrial-specific currents .

Table 2: Experimental Systems for KCNA5 Studies

SystemApplicationOutcomeSource
HEK293 CellsPatch-clamp analysisConfirmed hyperpolarizing shifts in inactivation
Rabbit Portal Vein MyocytesImmunocytochemistryConfirmed Kv1.5 expression in smooth muscle
Mouse Heart SectionsImmunofluorescenceLocalized KCNA5 to atrial myocytes

Disease Associations

KCNA5 dysfunction is implicated in:

  • Atrial Fibrillation (AF): Both gain-of-function (e.g., E48G, A305T) and loss-of-function mutations alter IKur_{Kur}, increasing AF susceptibility .

  • Pulmonary Arterial Hypertension (PAH): Reduced KCNA5 expression enhances pulmonary vasoconstriction .

  • Hypothyroidism-Induced Arrhythmias: Downregulation of KCNA5 prolongs ventricular repolarization .

Expression and Purification

Recombinant rabbit KCNA5 is produced via:

  • Cell-Free Expression Systems: Achieves ≥85% purity, stored at -20°C in glycerol-containing buffers .

  • Mammalian Systems: HEK293 or L cells for functional studies .

Table 3: Expression Parameters

ParameterDetailsSource
Host SystemCell-free (Nicotiana tabacum lysate) or HEK293 cells
Purity≥85% (SDS-PAGE verified)
StabilityStable for ≥2 years at -20°C

Pharmacological Properties

KCNA5 is sensitive to:

  • 4-Aminopyridine (4-AP): IC50_{50} ≈ 0.27 mM .

  • Tetraethylammonium (TEA): Partial block at 330 mM .

  • Oxidative Stress: Hydrogen peroxide suppresses promoter activity via Sp1 transcription factor .

Future Directions

  • Therapeutic Targeting: Modulating KCNA5 currents to treat atrial fibrillation or pulmonary hypertension .

  • Mechanistic Studies: Elucidating T1 domain interactions with β-subunits (e.g., KVβ2) for channel regulation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNA5; Potassium voltage-gated channel subfamily A member 5; Voltage-gated potassium channel subunit Kv1.5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
KCNA5
Target Protein Sequence
MEIALGPLENGGAMTIRGGGEETAGCSQAAPTAGLGDGSQEPAPRGRGCSARRGAEPGER PLPPQPPELPQSRRSPLEEEEGEGDPGLSVAEEQTLGAGALHHQRVLINISGLRFETQLG TLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVF ADEIRFYQLGDEAMERFREDEGFIKDEEKPLPRNEFQRQVWLIFEYPESSGSARAIAIVS VLVILISIITFCLETLPEFKDERELLRHPPVPHQPPAAPALGANGSGAVAPASGSTVAPL LPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDIVAIFPYFITLGTE LAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELG LLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTTVGYGDMRPITVGGKI VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEPGSQSRGTSLDAGGQRK ASWSKASLCKAGGSLETADSVRRGSCLLEKYNLKAKSNVDLRRSLYALCLDTSRETDL
Uniprot No.

Target Background

Function
This voltage-gated potassium channel mediates potassium transport across excitable cell membranes. It forms tetrameric potassium-selective channels, enabling potassium ions to pass according to their electrochemical gradient. The channel transitions between open and closed conformations in response to membrane voltage changes. It can form functional homotetrameric channels and heterotetrameric channels with varying proportions of KCNA1, KCNA2, KCNA4, KCNA5, and potentially other family members. The channel properties are dependent on the specific alpha subunits comprising the channel. Cytoplasmic beta subunits modulate channel properties by influencing the subcellular localization of alpha subunits and promoting rapid inactivation. Homotetrameric channels exhibit rapid activation and slow inactivation. This protein may play a role in regulating insulin secretion in normal pancreatic islets.
Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.5/KCNA5 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNA5 and what is its physiological significance?

KCNA5, also known as Kv1.5, belongs to the shaker-related subfamily of voltage-gated potassium channels. It consists of six membrane-spanning domains with a shaker-type repeat in the fourth segment . As a delayed rectifier class channel, KCNA5 plays a crucial role in restoring the resting membrane potential of neurons and cardiac muscle cells following depolarization .

In cardiac physiology, human KCNA5 conducts the ultra-rapid delayed rectifier potassium current (IKur) and serves as a key determinant of the atrial action potential . The channel's importance extends beyond cardiac function, as KCNA5 also regulates vascular tone in smooth muscle cells and influences cell proliferation in various tissues .

Rabbit KCNA5, particularly from vascular smooth muscle, shares structural and functional similarities with other mammalian KCNA5 channels but possesses unique properties that make it valuable for comparative studies of channel function across species .

How does rabbit KCNA5 compare structurally to KCNA5 from other species?

Rabbit KCNA5 from vascular smooth muscle (specifically portal vein) encodes a protein of 598 amino acid residues with the characteristic features of the Kv superfamily of potassium channels . Interestingly, rabbit portal vein KCNA5 (RPVKv1.5) is identical in amino acid sequence to rabbit cardiac Kv1.5, despite having six silent mutations in the nucleotide sequence .

When compared to KCNA5 channels from other species, rabbit KCNA5 shows significant homology but with notable differences. The amino acid sequence of RPVKv1.5 is similar, but not identical, to Kv1.5 channels from:

  • Canine colonic smooth muscle

  • Human ventricular muscle

  • Human pancreas

The differences primarily occur in three regions:

  • The cytoplasmic N-terminal region

  • The cytoplasmic C-terminal region

  • The S1-S2 linker region

These structural variations likely contribute to species-specific differences in channel function, pharmacology, and regulation, highlighting the importance of species consideration in KCNA5 research.

What are the key regulatory sites in rabbit KCNA5?

Rabbit KCNA5 contains several consensus phosphorylation sites that are critical for channel regulation . These post-translational modification sites provide mechanisms for dynamic control of channel activity in response to various physiological stimuli.

The key regulatory sites in rabbit KCNA5 include:

  • PKA (Protein Kinase A) phosphorylation sites:

    • 539RKAS542 near the C-terminus

    • 562RRGS565 near the C-terminus

  • PKC (Protein Kinase C) phosphorylation sites:

    • 47RGCSARR53 near the N-terminus

    • 545KASLCK550 near the C-terminus

These phosphorylation sites suggest that rabbit KCNA5 activity is modulated by both sympathetic (via PKA) and other signaling pathways (via PKC). Researchers investigating channel regulation should consider these sites when designing experiments to study how phosphorylation affects channel properties such as voltage dependence, kinetics, and trafficking.

What are the optimal methods for cloning recombinant rabbit KCNA5?

The cloning of recombinant rabbit KCNA5 requires careful consideration of tissue source, RNA extraction techniques, and PCR strategies. Based on established protocols, the following methodological approach has proven effective:

  • Tissue Selection and Preparation:

    • Portal vein tissue from rabbits (2-2.5 kg) provides a reliable source

    • Careful removal of adventitia and endothelium is critical to ensure myocyte-specific mRNA

    • Tissue should be promptly processed to minimize RNA degradation

  • mRNA Isolation:

    • Extraction of total RNA from homogenized tissue using a denaturing solution

    • Isolation of poly(A)+ RNA from total RNA using a mRNA PolyATract system

    • Approximately 9 μg of mRNA can be obtained from ten rabbit portal veins

  • RT-PCR Strategy:

    • Conversion of poly(A)+ RNA (0.5 μg) to cDNA using reverse transcriptase with oligo(dT) primers

    • PCR amplification using primers based on known sequences (e.g., rabbit cardiac Kv1.5)

    • Recommended PCR conditions: 35 cycles of 98°C for 30s, 60°C for 30s, and 72°C for 2 min

    • Incorporation of appropriate restriction sites (e.g., EcoRI, BamHI) in primers to facilitate subcloning

  • Sequence Verification and Correction:

    • Subcloning of amplified products into appropriate vectors (e.g., pBluescript II SK(+))

    • Sequence determination of multiple full-length PCR clones

    • Identification and correction of PCR-induced mutations by generating a composite construct using restriction enzymes

This systematic approach ensures the generation of an accurate and functional rabbit KCNA5 clone suitable for expression studies and functional characterization.

How do the electrophysiological properties of recombinant rabbit KCNA5 compare with native channels?

Comparative electrophysiological analysis reveals both similarities and differences between recombinant rabbit KCNA5 and native Kv1.5 channels in rabbit portal vein myocytes. These comparisons provide important insights into how expression systems influence channel behavior.

Current Density Comparison:

Channel TypeEnd-pulse Current Density (pA/pF) at +30mVTail Current Density (pA/pF)
RPVKv1.5 in L cells694.7 ± 116.586.4 ± 15.6
Native KDR in RPV myocytes43.5 ± 6.34.3 ± 0.9

The recombinant channels expressed in L cells demonstrate significantly higher current density than native channels (p < 0.05), likely reflecting higher expression levels in the heterologous system .

Activation Kinetics Comparison:

Channel TypeFast τ at +30mV (ms)Slow τ at +30mV (ms)
RPVKv1.5 in L cellsValue not specifiedValue not specified
Native KDR in RPV myocytesNot significantly different from L cellsNot significantly different from L cells
RPVKv1.5 in HEK293 cellsSignificantly faster than L cellsSignificantly faster than L cells

Deactivation Kinetics Comparison:

Channel TypeFast τ at -50mV (ms)Slow τ at -50mV (ms)
RPVKv1.5 in L cellsValue not specifiedValue not specified
Native KDR in RPV myocytesSimilar to L cellsSimilar to L cells
RPVKv1.5 in HEK293 cellsSlower than L cellsSlower than L cells

These data indicate that:

  • Activation and deactivation of both native KDR currents and L cell-expressed RPVKv1.5 follow double exponential kinetics

  • Native KDR channels and L cell-expressed RPVKv1.5 display similar time constants of activation and deactivation

  • The same channel expressed in different cell types (L cells vs. HEK293 cells) exhibits different kinetic properties

These findings highlight the importance of considering the expression system when interpreting electrophysiological data from recombinant channels.

What role does KCNA5 dysfunction play in pathophysiological conditions?

KCNA5 dysfunction has been implicated in various pathophysiological conditions, making it an important target for therapeutic intervention. Research has identified several disease states associated with altered KCNA5 function or expression:

  • Atrial Fibrillation (AF):

    • KCNA5 conducts the ultra-rapid delayed rectifier potassium current (IKur) in atria

    • Alterations in KCNA5 function contribute to abnormal atrial action potential duration

    • KCNA5 represents a promising target for AF-selective therapy due to its predominant atrial expression

  • Pulmonary Arterial Hypertension (PAH):

    • 17 single-nucleotide polymorphisms of the KCNA5 gene have been identified in PAH patients

    • These genetic variations may contribute to KCNA5 downregulation, leading to increased vascular tone

    • In intrauterine growth retardation, decreased KCNA5 expression coupled with increased tyrosine-phosphorylation promotes pulmonary artery smooth muscle cell proliferation

    • This proliferative effect results in pulmonary arterial wall thickening characteristic of PAH

  • Neoplastic Conditions:

    • KCNA5 is associated with Src family protein tyrosine kinases in astrocytes

    • This association plays a role in astrocyte proliferation

    • The connection between KCNA5 and cell proliferation has prompted numerous tumor-related studies

    • Research indicates that Caveolin-1 facilitates KCNA5 expression, promoting breast cancer progression

Understanding these pathophysiological roles provides a foundation for developing targeted therapeutic strategies that modulate KCNA5 function in a disease-specific manner.

What approaches are effective for studying KCNA5 channel pharmacology?

Investigating KCNA5 channel pharmacology requires robust experimental approaches that allow for precise measurement of channel function and drug interactions. Several methodological strategies have proven effective:

  • Electrophysiological Techniques:

    • Whole-cell patch-clamp recordings provide comprehensive assessment of channel function

    • Cell-attached and inside-out patch configurations offer insights into single-channel properties

    • Key recording solutions for whole-cell voltage clamp:

      • Bath solution (mM): 120 NaCl, 3 NaHCO3, 4.2 KCl, 1.2 KH2PO4, 0.5 MgCl2, 10 glucose, 1.8 CaCl2, 10 Hepes (pH 7.4)

      • Pipette solution (mM): 110 potassium gluconate, 30 KCl, 0.5 MgCl2, 5 Hepes, 5 Na2ATP, 1 GTP, 10 BAPTA

  • Heterologous Expression Systems:

    • L cells and HEK293 cells provide reliable platforms for recombinant KCNA5 expression

    • Co-transfection with green fluorescent protein (GFP) facilitates identification of transfected cells

    • Lipofectin-mediated transfection has been optimized for efficient uptake and expression

  • Peptide Inhibitor Studies:

    • Peptide inhibitors offer a targeted approach to modulating KCNA5 function

    • Rational drug design can improve peptide affinity and selectivity for KCNA5

    • In silico docking experiments guide targeted modification of amino acid sequences

  • Comparative Pharmacology:

    • Comparing drug effects across species and expression systems reveals important insights

    • Testing compounds on both recombinant channels and native tissues allows assessment of specificity

    • Pharmacological differences between expression systems should be carefully considered when interpreting results

These approaches provide a comprehensive toolkit for researchers investigating KCNA5 pharmacology, facilitating the development of novel therapeutic agents for conditions involving KCNA5 dysfunction.

What immunological techniques are effective for detecting rabbit KCNA5?

Immunological detection of rabbit KCNA5 requires careful selection of antibodies and optimization of experimental protocols. Based on established research methods, the following approaches have proven effective:

  • Antibody Selection:

    • Polyclonal antibodies raised against C-terminal epitopes of KCNA5 show good specificity

    • Antibodies raised against mouse KCNA5 C-terminal epitopes cross-react effectively with rabbit KCNA5

    • Commercial options include rabbit polyclonal antibodies with concentration of 0.25 mg/ml purified IgG

  • Immunocytochemistry Protocol:

    • Freshly dispersed rabbit portal vein cells should be allowed to settle and adhere to acid-washed coverslips

    • Cell permeabilization using 0.1% Triton X-100 in Pipes-buffered solution for 5 minutes

    • Incubation with primary antibody at 1:70 dilution overnight at 4°C

    • Secondary antibody incubation (goat anti-rabbit IgG conjugated with TRITC, CY3, or FITC) at 1:100 dilution for 1 hour

    • Washing steps using Pipes solution containing 0.5% bovine serum albumin

  • Western Blot Applications:

    • KCNA5 antibodies validated for Western blot can detect the approximately 67 kDa KCNA5 protein

    • Effective for materials from rodent and human tissues

    • Can be used to quantify changes in KCNA5 expression under various experimental conditions

  • Controls and Validation:

    • Control cells exposed to secondary antibody alone are essential to assess non-specific binding

    • Multiple biological replicates (e.g., preparations from different rabbits) ensure reliability

    • Observation of at least 15 cells per treatment group is recommended for representative results

These techniques provide researchers with reliable tools for investigating KCNA5 expression and localization in rabbit tissues, facilitating studies of channel regulation and trafficking.

What are the optimal conditions for expressing recombinant rabbit KCNA5 in mammalian cells?

Successful expression of recombinant rabbit KCNA5 in mammalian cells requires optimization of several key parameters. The following conditions have been established to achieve efficient expression and functional channel activity:

  • Expression Vector Selection:

    • Subcloning of KCNA5 cDNA into mammalian expression vectors such as pcDNA3

    • Incorporation of appropriate restriction sites (e.g., KpnI and BamHI) for directional cloning

    • Co-expression with reporter genes (e.g., GFP) to identify transfected cells

  • Cell Line Selection:

    • Mouse connective tissue L cells and human embryonic kidney (HEK293) cells both support robust KCNA5 expression

    • Expression in different cell lines yields channels with subtly different electrophysiological properties

    • Cell choice should be guided by the specific research question and desired channel characteristics

  • Transfection Protocol:

    • Lipofectin-mediated transfection optimized for KCNA5 expression

    • For 80% confluent cultures (30 mm dish):

      • 3 μg of DNA and 20 μl of lipofectin per dish

      • 5-hour incubation in serum-free medium

      • Restoration of standard culture medium overnight before splitting cells

    • Transfected cells should be used within 72 hours for optimal expression

  • Culture Conditions:

    • Maintenance in Dulbecco's modified Eagle's medium supplemented with 10% fetal bovine serum

    • Incubation under 10% CO2 atmosphere

    • Regular passaging every 5-6 days by mechanical disruption

    • Transfer to acid-washed coverslips for electrical recordings

  • Expression Verification:

    • Successful transfection identified by GFP fluorescence

    • Functional expression confirmed by whole-cell voltage clamp recordings

    • 100% of GFP-positive cells should display time-dependent outward K+ current

    • Control cells (transfected with GFP alone or untransfected) should not display time-dependent outward K+ current

These optimized conditions provide a reliable framework for expressing functional recombinant rabbit KCNA5 channels in mammalian cells, facilitating detailed electrophysiological and pharmacological investigations.

What electrophysiological protocols are most informative for characterizing KCNA5 function?

Comprehensive characterization of KCNA5 function requires carefully designed electrophysiological protocols that reveal the channel's biophysical properties. The following experimental approaches provide valuable insights into KCNA5 behavior:

  • Voltage-Dependent Activation:

    • Holding potential of -60 mV

    • Series of test pulses between -80 and +30 mV

    • Analysis of end-pulse currents and tail currents

    • Calculation of current density (pA/pF) to normalize for cell size

    • Fitting activation kinetics with double exponential functions to extract fast and slow time constants

  • Deactivation Kinetics:

    • Repolarization to -50 mV following activating pulses

    • Recording of tail currents during repolarization

    • Fitting with double exponential functions to determine fast and slow deactivation time constants

    • Comparison across different expression systems to assess context-dependent properties

  • Single-Channel Recordings:

    • Cell-attached patch configuration for physiological assessment

    • Inside-out patch configuration for investigating cytoplasmic modulators

    • Standard solutions for cell-attached recordings:

      • Pipette solution (mM): 140 KCl, 1 CaCl2, 1 MgCl2, 5.5 glucose, 10 Hepes (pH 7.4)

      • Bath solution (mM): 140 KCl, 1 MgCl2, 5.5 glucose, 10 Hepes (pH 7.4), nominally Ca2+ free

    • For asymmetrical K+ conditions: 5.4 mM KCl in pipette with equimolar NaCl substitution

  • Pharmacological Characterization:

    • Application of known K+ channel blockers (e.g., 4-AP)

    • Dose-response relationships to determine potency (EC50/IC50 values)

    • Comparison of pharmacological profiles between recombinant and native channels

    • Assessment of peptide inhibitors designed through rational drug design approaches

  • Phosphorylation Studies:

    • Investigation of channel modulation at PKA and PKC consensus sites

    • Application of kinase activators or inhibitors to assess functional impact

    • Site-directed mutagenesis of phosphorylation sites to determine their functional significance

These protocols provide a comprehensive framework for functional characterization of KCNA5 channels, enabling detailed comparison between recombinant and native channels as well as assessment of physiological and pharmacological modulators.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.