Recombinant Rabbit Potassium voltage-gated channel subfamily D member 2 (KCND2)

Shipped with Ice Packs
In Stock

Description

Introduction to KCND2 and KvChannels

KCND2 (potassium voltage-gated channel subfamily D member 2) encodes the Kv4.2 protein, a pore-forming α-subunit of rapidly inactivating A-type potassium channels. These channels regulate neuronal excitability, cardiac repolarization, and circadian rhythms by modulating action potential dynamics . Kv4.2 forms tetrameric channels, often co-assembling with auxiliary subunits like KChIPs and DPP6/10 to fine-tune channel kinetics .

Recombinant KCND2 Protein (Human)

  • Production: Expressed in yeast as a 27 kDa partial protein (residues 406–630) with an N-terminal His-tag .

  • Function: Mediates transient potassium currents (ISAI_{SA}) in neurons and ItoI_{to} in rodent hearts .

  • Applications: Used in electrophysiological studies and structural analyses of channel modulation .

ParameterDetails
SourceYeast-expressed human KCND2 fragment (UniProt: Q9NZV8)
Molecular Weight27 kDa
Purity>90% (SDS-PAGE)
StorageTris buffer with 50% glycerol; stable for 6–12 months at -80°C

Recombinant Rabbit Antibodies

Rabbit-derived monoclonal and polyclonal antibodies (e.g., ab204942, APC-023, A6203) target intracellular or extracellular Kv4.2 epitopes for research applications :

  • Clonality: Both polyclonal (e.g., Covalab pab0330) and recombinant monoclonal (e.g., Proteintech 85133-2-PBS) formats exist .

  • Specificity: Cross-react with human, mouse, and rat KCND2 .

  • Applications: Western blot (1:100–1:5000 dilutions), immunohistochemistry, and flow cytometry .

Neuronal Excitability

  • Kv4.2 governs dendritic A-type currents (ISAI_{SA}), delaying action potential initiation and regulating back-propagation in cortical pyramidal neurons .

  • In Kv4.2 knockout mice, compensatory upregulation of delayed rectifier (IKI_K) and steady-state (IssI_{ss}) currents maintains neuronal firing thresholds despite ISAI_{SA} loss .

Cardiac Function

  • In heart failure models, KCND2 mRNA and protein downregulation correlate with reduced transient outward currents (ItoI_{to}) in rabbits, contributing to action potential prolongation .

  • Rodent-specific ItoI_{to} mediation by Kv4.2 contrasts with humans, where other subunits dominate .

Disease Associations

  • Epilepsy: Altered Kv4.2 expression links to hyperexcitability in temporal lobe epilepsy .

  • Circadian Rhythms: Modulates suprachiasmatic nucleus neuron firing, affecting locomotor activity .

Regulatory Mechanisms

  • Subunit Interactions: KChIP1–4 and DPP6/10 enhance surface expression, accelerate recovery from inactivation, and shift voltage dependencies .

  • Post-Translational Modifications: Phosphorylation sites (e.g., Ser 616) dynamically regulate channel trafficking and activity .

Therapeutic Targets

  • Toxins like Stromatoxin-1 and Phrixotoxin-1 selectively block Kv4.2 (IC₅₀: 1.2–100 nM), offering tools for channel modulation .

  • KCND2 mutations (e.g., L450F) are implicated in rare neurological disorders, highlighting its clinical relevance .

Antibody Comparison

AntibodyHostClonalityTarget RegionApplications
Covalab pab0330 RabbitPolyclonalC-terminal peptideWB, IF, ELISA
Proteintech 85133 RabbitMonoclonalFull-length KCND2CBA, Cytometry
Abcam ab204942 MouseMonoclonalExtracellular loopIHC, IP, WB

KCND2 Expression Profile

TissueExpression LevelFunctional Role
Brain NeuronsHigh Dendritic ISAI_{SA} regulation
Cardiac MyocytesRodent-specific ItoI_{to} mediation
Liver/OtherLow/Undetectable N/A

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate special format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize its development.
Synonyms
KCND2; Potassium voltage-gated channel subfamily D member 2; Voltage-gated potassium channel subunit Kv4.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-630
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
KCND2
Target Protein Sequence
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTCESALPTMTARQRVWRAFENPHT STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEEEPAFVSKSGSSFETQHHH LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI PNANVSGSQRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
Uniprot No.

Target Background

Function
Recombinant Rabbit Potassium voltage-gated channel subfamily D member 2 (KCND2) is a voltage-gated potassium channel that facilitates potassium transport across excitable cell membranes. While primarily found in the brain, it is also present in the rodent heart. KCND2 mediates a significant portion of the dendritic A-type current (I(SA)) in brain neurons. This current is activated at membrane potentials below the threshold for action potentials, playing a crucial role in regulating neuronal excitability. Specifically, it prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive firing, shortens the duration of action potentials, and influences the back-propagation of action potentials from the neuronal cell body to the dendrites. Furthermore, KCND2 contributes to the regulation of the circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, thus impacting the circadian rhythm of locomotor activity. It functions downstream of the metabotropic glutamate receptor GRM5, playing a role in neuronal excitability and nociception mediated by GRM5 activation. In rodent heart left ventricle apex cells, KCND2 mediates the transient outward current I(to), but this function is carried out by another family member in the human heart. KCND2 forms tetrameric potassium-selective channels, allowing potassium ions to pass through in accordance with their electrochemical gradient. The channel transitions between open and closed conformations in response to voltage changes across the membrane. While it can form functional homotetrameric channels, it also forms heterotetrameric channels with varying proportions of KCND2 and KCND3, with channel properties depending on the specific pore-forming alpha subunits present. In vivo, membranes likely contain a mixture of heteromeric potassium channel complexes. Interaction with specific isoforms of the regulatory subunits KCNIP1, KCNIP2, KCNIP3, or KCNIP4 significantly enhances cell surface expression, leading to increased channel activity. It modulates the kinetics of channel activation and inactivation, shifting the activation threshold to more negative voltage values, shifting the inactivation threshold to less negative voltages, and accelerating recovery after inactivation. Similarly, interaction with DPP6 or DPP10 promotes membrane expression and regulates both channel characteristics and activity.
Database Links
Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.2/KCND2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell junction, synapse. Perikaryon. Cell junction, synapse, postsynaptic cell membrane. Cell projection, dendritic spine. Cell membrane, sarcolemma. Cell junction. Membrane, caveola.
Tissue Specificity
Detected in brain frontal cortex.

Q&A

What is the fundamental function of KCND2 in cellular physiology?

KCND2 (Kv4.2) mediates transmembrane potassium transport in excitable membranes, predominantly in the brain and rodent heart. In neurons, it mediates the major component of dendritic A-type current I(SA), which activates at membrane potentials below the threshold for action potentials. Functionally, KCND2 regulates neuronal excitability, prolongs the latency before the first spike in action potential series, controls the frequency of repetitive action potential firing, shortens action potential duration, and regulates back-propagation of action potentials from neuronal cell bodies to dendrites . In rodent cardiac tissue, KCND2 mediates the transient outward current I(to) in left ventricle apex cells, though this function is performed by different channels in human heart .

How does KCND2 channel structure relate to its electrophysiological properties?

KCND2 forms tetrameric potassium-selective channels through which potassium ions pass according to their electrochemical gradient. The channel alternates between open and closed conformations in response to voltage differences across the membrane . KCND2 can form functional homotetrameric channels or heterotetrameric channels containing variable proportions of KCND2 and KCND3. The electrophysiological properties of these channels depend on the composition of pore-forming alpha subunits . This structural versatility allows for fine-tuning of channel kinetics in different cellular contexts, with biological membranes likely containing a mixture of heteromeric potassium channel complexes that enable precise regulation of cellular excitability.

What regulatory mechanisms control KCND2 function?

KCND2 channel function is regulated through multiple mechanisms. Interaction with specific isoforms of regulatory subunits KCNIP1, KCNIP2, KCNIP3, or KCNIP4 substantially increases cell surface expression and channel activity. These interactions modulate channel activation and inactivation kinetics, shift the threshold for channel activation to more negative voltage values, alter inactivation thresholds, and accelerate recovery after inactivation . Similarly, interaction with DPP6 or DPP10 promotes membrane expression and regulates channel characteristics. Post-translational modifications, particularly protein kinase C (PKC) phosphorylation at sites including S447, attenuate KCND2 membrane expression under normal conditions, providing another layer of regulation .

What are the optimal methods for expressing and studying recombinant rabbit KCND2 in heterologous systems?

For functional characterization of recombinant rabbit KCND2, Xenopus oocyte expression systems have proven particularly effective . The methodology typically involves:

  • Cloning KCND2 cDNA into appropriate expression vectors

  • In vitro transcription to generate cRNA

  • Microinjection of cRNA into Xenopus oocytes

  • Allowing 2-3 days for protein expression

  • Two-electrode voltage clamp recordings to assess channel properties

This system allows for the assessment of wild-type, mutant, and heteromeric channels under controlled conditions. For studying protein-protein interactions and trafficking, mammalian expression systems (HEK293 or CHO cells) coupled with immunofluorescence microscopy can be used to visualize subcellular localization. Patch-clamp electrophysiology in these systems provides high-resolution kinetic data under physiological conditions.

How can researchers effectively detect and quantify KCND2 expression in experimental systems?

Multiple validated approaches exist for KCND2 detection:

TechniqueApplicationAdvantagesConsiderations
Western BlottingProtein expression quantificationRobust quantification of total proteinCannot distinguish membrane vs. intracellular pools
ImmunohistochemistryTissue localizationPreserves tissue architectureRequires specific validated antibodies
Flow CytometryCell surface expressionSingle-cell quantificationRequires membrane-impermeant antibodies
qRT-PCRmRNA expressionHigh sensitivity for transcript levelsDoes not confirm protein translation
Cytometric Bead ArrayProtein quantificationHigh-throughput, multiplexableRequires validated antibody pairs

Recombinant rabbit monoclonal antibodies have demonstrated high specificity for KCND2 detection in methods including western blotting, immunohistochemistry (IHC-P, IHC-Fr), flow cytometry, and immunoprecipitation . For optimal results, researchers should select antibodies validated for their specific application and target species, with antibodies like those described in search result showing reactivity with human samples.

What are the methodological considerations when studying KCND2 mutations?

When investigating KCND2 mutations, comprehensive characterization requires a multi-level approach:

  • Biophysical characterization: Xenopus oocyte expression combined with voltage-clamp recording allows comparison of wild-type and mutant channel properties, including activation/inactivation kinetics and voltage-dependence .

  • Heteromeric channel assessment: Co-expression of mutant and wild-type channels (recapitulating heterozygosity) is essential, as is evaluation in hybrid channels with KCND3 to simulate endogenous heterotetrameric channels .

  • Regulatory response analysis: Testing channel response to regulatory mechanisms (e.g., PKC phosphorylation) is critical, as mutations may disrupt these pathways, as seen with the p.S447R mutation that impairs PKC regulation .

  • Cellular phenotype assessment: Evaluating the impact on cell physiology requires recording action potentials in relevant cell types (neurons, cardiomyocytes) expressing the mutant channels.

How is KCND2 implicated in cancer progression, particularly gastric cancer?

KCND2 has emerged as a significant factor in gastric cancer pathogenesis. Research has demonstrated that KCND2 is markedly elevated in gastric cancer tissues, with expression levels correlating with different cancer grades, T stages, and N stages . Functionally, KCND2 enhances the viability of gastric cancer cells by:

  • Boosting cancer cell proliferation

  • Reducing cancer cell death rates

  • Stimulating NF-κB signaling both in cellular and animal models

  • Promoting immune system modulation through association with M2 macrophages

Mechanistically, KCND2 activates NF-κB, which leads to the infiltration of M2 macrophages, ultimately promoting gastric cancer advancement. These findings position KCND2 as both a prognostic biomarker and a potential therapeutic target for gastric cancer .

What is the evidence for KCND2's role in cardiac arrhythmias?

Genetic studies have identified a p.S447R mutation in KCND2 as causative for autosomal dominant early-onset nocturnal paroxysmal atrial fibrillation . This mutation exhibits several pathological effects:

  • It increases the channel's inactivation time constant

  • It disrupts a PKC phosphorylation site that normally attenuates Kv4.2 membrane expression

  • Due to impaired PKC response, mutant KCND2 shows augmented membrane expression

  • This leads to enhanced potassium currents

  • The mutation exerts a gain-of-function effect on both Kv4.2 homotetramers and Kv4.2-Kv4.3 heterotetramers

These alterations presumably increase the repolarizing potassium current I(to), abbreviating action potential duration and creating an arrhythmogenic substrate specifically for nocturnal atrial fibrillation. This finding connects ion channel mutations directly to specific temporal patterns of arrhythmia, adding to our understanding of circadian aspects of cardiac electrophysiology.

How does KCND2 influence immune cell function in the tumor microenvironment?

KCND2 has been identified as a regulator of immune function within the tumor microenvironment, particularly in gastric cancer. Research has demonstrated that KCND2 influences immune cell infiltration and function through several mechanisms:

  • KCND2 promotes the infiltration of M2 macrophages, which typically exhibit pro-tumorigenic properties

  • This macrophage regulation occurs through KCND2-mediated activation of NF-κB signaling pathways

  • M2 macrophages in the tumor microenvironment contribute to cancer progression through immunosuppression and promotion of angiogenesis

These findings suggest KCND2 may serve as a bridge between cancer cell intrinsic properties and the remodeling of the immune microenvironment, pointing to potential therapeutic strategies that could target both the cancer cells and their immunological niche.

What approaches can be used to target KCND2 therapeutically in cancer?

Based on KCND2's role in gastric cancer progression and immune modulation, several therapeutic strategies warrant investigation:

  • Small molecule inhibitors: Development of specific KCND2 channel blockers could interrupt cancer cell proliferation signaling. These would need to be highly selective to avoid off-target effects on other potassium channels.

  • Gene silencing approaches: RNAi or CRISPR-based therapies targeting KCND2 expression could reduce its oncogenic effects. Delivery systems would need optimization for tumor specificity.

  • Disruption of protein-protein interactions: Compounds that interfere with KCND2's activation of NF-κB signaling could prevent downstream effects on cancer progression.

  • Dual-targeting approaches: Combining KCND2 inhibition with immunotherapies targeting M2 macrophages could synergistically address both the cancer cells and the tumor microenvironment .

  • Biomarker-guided therapy: As KCND2 expression correlates with prognosis, it could serve as a stratification marker for selecting patients most likely to benefit from targeted therapies.

How can researchers effectively model the complex interactions between KCND2 function and immune regulation?

Modeling KCND2's role in immune regulation requires sophisticated experimental systems:

  • Co-culture systems: Developing in vitro co-culture models of cancer cells with variable KCND2 expression alongside immune cells, particularly macrophages, can help elucidate cell-cell communication.

  • 3D organoid models: Patient-derived organoids with manipulated KCND2 expression allow examination of complex cellular interactions in a more physiologically relevant context.

  • In vivo models with immune competence: Syngeneic mouse models or humanized mouse models permit examination of KCND2's effects on tumor growth and immune infiltration.

  • Multi-omics approaches: Integrating transcriptomics, proteomics, and immune profiling of tumors with variable KCND2 expression can identify key signaling nodes and regulatory networks.

  • Systems biology modeling: Computational models incorporating KCND2 signaling and immune regulatory networks can generate testable hypotheses about intervention points.

What are the technical challenges in distinguishing the roles of KCND2 in heteromeric channels versus homomeric channels?

Investigating KCND2 function within different channel compositions presents significant methodological challenges:

  • Selective expression systems: Developing expression systems that allow controlled expression of specific KCND2:KCND3 ratios to mimic physiological heteromeric channels.

  • Subunit-specific tagging: Using differentially tagged subunits to track assembly and trafficking of homo- versus heteromeric channels.

  • Selective pharmacology: Identifying compounds with selectivity for different channel compositions to probe function in native systems.

  • Single-molecule imaging: Applying super-resolution microscopy techniques to visualize channel composition and distribution in native membranes.

  • Subunit-specific antibodies: Developing antibodies that can distinguish between different channel compositions in tissues.

  • Computational modeling: Creating structural models that predict how different subunit compositions affect channel properties and drug interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.