Recombinant Rabbit Potassium voltage-gated channel subfamily D member 3 (KCND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag based on your request.
Synonyms
KCND3; Potassium voltage-gated channel subfamily D member 3; Voltage-gated potassium channel subunit Kv4.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-655
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
KCND3
Target Protein Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKSKRQDELIVLNVSGRRFQTWRTTLER YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTASLIESQHHHLL HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHA GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG LRPNCKTSQITTAIISIPAPPALTPEGETRPPPASPGPNTNIPSIASNVVKVSVL
Uniprot No.

Target Background

Function
The pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. This subunit may contribute to I(To) current in the heart and I(Sa) current in neurons. Channel properties are regulated by interactions with other alpha subunits and regulatory subunits.
Database Links
Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.3/KCND3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell projection, dendrite.
Tissue Specificity
Detected in carotid body chemoreceptor cells and in frontal cortex.

Q&A

What is KCND3 and what roles does it play in cellular physiology?

KCND3 is a gene that encodes the Kv4.3 voltage-gated potassium channel, which is primarily responsible for transient outward potassium currents (I₁₀) in neurons and cardiac tissue. In neurons, particularly Purkinje cells, Kv4.3 channels regulate neuronal excitability, action potential repolarization, and firing frequency patterns. The functional expression of these channels is critical for cerebellar function and coordination . In cardiac tissue, these channels contribute to early repolarization of cardiac action potentials and are implicated in arrhythmogenesis when dysfunctional. Kv4.3 channels typically form tetrameric structures composed of four alpha subunits, creating a central pore through which potassium ions pass selectively .

How do recombinant rabbit KCND3 models differ from human KCND3 in research applications?

Recombinant rabbit KCND3 models offer several research advantages while maintaining high homology with human KCND3. Rabbit Kv4.3 channels share approximately 98% sequence identity with human Kv4.3 in critical functional domains, including the pore loop and voltage-sensing segments. This high conservation makes rabbit models valuable for translational research while providing specific benefits:

  • Rabbit Kv4.3 exhibits slightly altered gating kinetics that can enhance electrophysiological resolution in certain experimental paradigms

  • Rabbit models often demonstrate more consistent protein expression in heterologous systems

  • The subtle structural differences can provide insights into structure-function relationships when compared with human variants

When designing experiments, researchers should account for these minor differences, particularly when extrapolating findings to human physiology or pathophysiology .

What expression systems are most effective for recombinant rabbit KCND3 studies?

Several expression systems have proven effective for recombinant rabbit KCND3 studies, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
Xenopus laevis oocytes- High expression levels
- Well-suited for two-electrode voltage-clamp
- Cost-effective
- Non-mammalian post-translational modifications
- Limited for trafficking studies
- Initial characterization
- Mutational studies
- Pharmacological screening
HEK293T cells- Mammalian processing
- Compatible with immunocytochemistry
- Suitable for patch-clamp
- Lower expression than oocytes
- More technical expertise required
- Trafficking studies
- Protein-protein interactions
- Detailed biophysical characterization
Primary neuronal cultures- Native cellular environment
- Physiological relevance
- Complex system with many variables
- Technically challenging
- Synaptic integration studies
- Native regulatory mechanisms

For basic functional characterization, Xenopus oocytes remain popular due to their robustness and high expression levels, as demonstrated in studies of Kv4.3 variants . For more complex investigations involving trafficking, protein interactions, or regulatory pathways, mammalian expression systems like HEK293T cells are preferable .

What are the essential components required for proper functional expression of recombinant rabbit KCND3?

Proper functional expression of recombinant rabbit KCND3 requires consideration of several critical components:

  • Regulatory β-subunits: Co-expression with KChIP2 (potassium channel interacting protein 2) is often essential for physiological channel function. KChIP2 enhances membrane trafficking, modulates inactivation kinetics, and can rescue certain trafficking-deficient mutants .

  • Expression vector selection: Vectors with strong promoters (e.g., CMV) and appropriate reporter genes (GFP or dsRed2) facilitate expression monitoring. Bicistronic vectors like pIRES2 allow simultaneous expression of Kv4.3 and regulatory subunits .

  • Post-translational modifications: Functional expression depends on proper glycosylation and phosphorylation, which may differ between expression systems.

  • Temperature conditions: Expression at lower temperatures (28-30°C instead of 37°C) often improves membrane trafficking of challenging constructs.

  • Transfection reagent optimization: Lipofection methods typically work well for KCND3 in mammalian cells, while mRNA injection is preferred for oocytes.

Research indicates that co-expression with KChIP2 can significantly attenuate dysfunction caused by pathogenic KCND3 variants, suggesting the importance of regulatory partners in experimental design .

How can researchers verify the membrane localization of recombinant rabbit KCND3?

Verification of membrane localization is critical for interpreting functional studies of Kv4.3 channels. Multiple complementary approaches provide robust confirmation:

  • Immunocytochemistry with quantitative analysis: Transfect cells with tagged constructs or use Kv4.3-specific antibodies, followed by confocal microscopy. Calculate the membrane-to-cytoplasm fluorescence ratio (Fm/Fc) as a quantitative measure of membrane localization. This approach was effective in distinguishing the V374A variant, which reaches the membrane, from other variants with trafficking defects .

  • Surface biotinylation assays: Selectively label surface proteins with membrane-impermeable biotin reagents, followed by streptavidin pulldown and Western blotting for Kv4.3.

  • Electrophysiological confirmation: Functional expression measured through voltage-clamp recordings provides indirect confirmation of membrane localization. Patch-clamp techniques can be used to measure characteristic transient outward potassium currents.

  • FRAP analysis: Fluorescence recovery after photobleaching can assess membrane mobility of fluorescently-tagged Kv4.3 channels.

Researchers should combine at least two of these approaches to reliably confirm membrane localization, as certain mutations may affect trafficking while others primarily impact function despite proper localization .

How should researchers design experiments to distinguish trafficking defects from functional impairments in KCND3 variants?

Distinguishing trafficking defects from functional impairments requires a systematic experimental approach:

  • Stepwise analysis protocol:

    • Begin with expression studies using fluorescent protein-tagged constructs to assess subcellular localization

    • Quantify membrane-to-cytoplasm fluorescence ratios (Fm/Fc)

    • Perform surface biotinylation assays to confirm membrane expression levels

    • Conduct electrophysiological recordings to measure channel conductance

    • Compare current density (pA/pF) relative to wild-type channels

    • Analyze gating parameters (activation/inactivation kinetics, voltage dependence)

    • Co-express with KChIP2 to assess rescue potential

  • Interpretive framework:

    • Reduced current with normal gating properties suggests trafficking defects

    • Normal expression with altered kinetics indicates functional impairments

    • Current reduction with altered kinetics suggests combined defects

The V374A variant demonstrates how this approach can identify primary mechanisms—despite adequate membrane localization (confirmed by immunohistochemistry), this variant shows severely reduced currents with preserved kinetic properties when co-expressed with wild-type channels, indicating a dominant-negative effect rather than a trafficking defect .

What methodologies can resolve the dominant-negative effects of mutant KCND3 on wild-type channels?

Resolving dominant-negative effects requires methodological approaches that can distinguish between heteromeric channel populations:

  • Titration experiments: Express varying ratios of wild-type to mutant channels (e.g., 1:0, 0.75:0.25, 0.5:0.5, 0.25:0.75, 0:1) and measure the resulting current amplitude and properties. A non-linear reduction in current amplitude with increasing mutant ratio suggests dominant-negative effects .

  • Mathematical modeling: Apply binomial distribution models to predict the proportion of functional channels given different stoichiometric assumptions. Compare experimental results with theoretical predictions to determine the likely oligomeric state and subunit interactions.

  • Single-channel recordings: Perform patch-clamp recordings in cell-attached or excised patch configurations to directly observe the properties of individual channels and determine if heteromeric channels with mutant subunits have altered conductance or open probability.

  • FRET analysis: Use fluorescently tagged wild-type and mutant subunits with Förster resonance energy transfer (FRET) to confirm physical interaction and co-assembly.

  • Computational simulations: Implement computational models, like those using the NEURON platform, to predict the functional consequences of reduced channel conductance on neuronal excitability .

Research on SCA19/22-associated variants demonstrates that co-expression of mutant subunits can reduce currents significantly more than would be expected from simple haploinsufficiency. For instance, the V374A variant reduced currents by approximately 81% when co-expressed at a 0.5:0.5 ratio with wild-type, consistent with a dominant-negative mechanism .

How can computational modeling inform KCND3 research and predict neuronal effects of channel variants?

Computational modeling provides powerful insights that bridge molecular findings with cellular physiology:

  • Integrative neuronal models: The NEURON simulation environment can incorporate detailed Kv4.3 channel kinetics along with other conductances to predict effects on Purkinje cell firing patterns. Such models have demonstrated that reduced Kv4.3 conductance increases Purkinje neuron firing frequency, providing a potential mechanism for cerebellar dysfunction in SCA19/22 .

  • Modeling approaches:

    • Implement Hodgkin-Huxley-type models with parameters derived from experimental data

    • Incorporate detailed morphological reconstructions of neurons

    • Include all major ionic conductances (Nav, Kv1, Kv3, Kv4, P-type calcium channels, etc.)

    • Simulate varying degrees of Kv4.3 dysfunction to predict dose-dependent effects

    • Test interactions with regulatory proteins like KChIP2

  • Model validation: Compare model predictions with:

    • Electrophysiological recordings from neurons expressing mutant channels

    • Clinical phenotypes of patients with specific variants

    • Calcium imaging data from affected neurons

  • Limitations to consider:

    • Models require accurate kinetic parameters from experimental data

    • Channel modulation by intracellular signaling is often simplified

    • Compensatory mechanisms may not be fully captured

Computational studies have successfully predicted neuronal hyperexcitability with reduced Kv4.3 function, consistent with the neurological symptoms observed in SCA19/22 patients .

How do mutations in KCND3 contribute to spinocerebellar ataxia and what can rabbit models reveal?

Mutations in KCND3 contribute to spinocerebellar ataxia type 19/22 (SCA19/22) through several mechanisms that can be investigated using rabbit KCND3 models:

  • Loss of function mechanisms:

    • Impaired channel trafficking to the cell membrane

    • Reduced current density despite normal trafficking

    • Altered voltage dependence or kinetics of activation/inactivation

    • Dominant-negative effects on wild-type channel assembly

  • Cellular consequences:

    • Altered Purkinje cell excitability and firing patterns

    • Disrupted synaptic integration and cerebellar circuit function

    • Progressive Purkinje cell loss and cerebellar atrophy

    • Variable cognitive dysfunction possibly related to extracerebellar Kv4.3 expression

Recombinant rabbit KCND3 models offer valuable insights because:

  • They can be used to introduce human disease mutations for functional characterization

  • The high sequence conservation ensures the pathogenic mechanisms are preserved

  • Rabbit models allow comparison between species to identify conserved pathophysiological pathways

Experimental evidence has confirmed that SCA19/22-associated mutations typically exert dominant-negative effects on wild-type channels. For example, the V374A variant reduces current by 81% when co-expressed with wild-type, while the T352P variant reduces current by 52% in the presence of KChIP2 .

What is the relationship between KCND3 mutations and cardiac arrhythmias, and how can this be studied?

KCND3 mutations have been implicated in cardiac arrhythmias and sudden unexpected death (SUD), with distinct electrophysiological profiles compared to neurological variants:

  • Arrhythmia mechanisms:

    • Gain-of-function mutations (e.g., p.Val392Ile, p.Gly600Arg) increase Kv4.3 current density by 50-100%

    • Increased currents accelerate early repolarization in cardiac action potentials

    • Altered recovery from inactivation (e.g., 3.6-fold slower in p.Val392Ile)

    • These changes create a substrate for ventricular arrhythmias

  • Methodological approaches:

    • Heterologous expression systems with cardiac-specific regulatory proteins

    • Inclusion of KChIP2, which is highly expressed in heart tissue

    • Action potential clamp techniques to assess impact on cardiac repolarization

    • Cardiac-specific computational modeling

  • Translational considerations:

    • Rabbit cardiac electrophysiology more closely resembles human than mouse models

    • Rabbit cardiac action potentials have similar phase 1 repolarization mediated by Kv4.3

    • Allows more accurate prediction of proarrhythmic effects in humans

Research has identified KCND3 mutations in approximately 1.6% of sudden unexplained death syndrome (SUDS) cases, with functional studies confirming increased current density and altered kinetics that could predispose to lethal arrhythmias .

How can research on KCND3 variants inform potential therapeutic approaches for channelopathies?

Research on KCND3 variants provides multiple avenues for therapeutic development:

  • KChIP2-based approaches:

    • Studies show KChIP2 co-expression can rescue trafficking defects in some mutants

    • Compounds enhancing KChIP2-Kv4.3 interaction could be therapeutic

    • Small molecules mimicking KChIP2 functional domains may restore channel function

  • Pharmacological modulation:

    • Channel openers for loss-of-function variants (neurological disorders)

    • Channel blockers for gain-of-function variants (cardiac arrhythmias)

    • Drugs targeting specific gating parameters (activation vs. inactivation)

  • Gene therapy strategies:

    • Antisense oligonucleotides to reduce expression of dominant-negative mutants

    • CRISPR-based approaches for allele-specific targeting

    • Viral delivery of wild-type KCND3 to compensate for haploinsufficiency

  • Acetazolamide mechanism:

    • Clinical evidence shows acetazolamide responsiveness in paroxysmal ataxia with KCND3 mutations

    • Suggests carbonic anhydrase inhibition may indirectly modulate channel function

    • Provides proof-of-concept for symptomatic treatment of channelopathies

  • High-throughput screening platforms:

    • Fluorescence-based assays to identify compounds restoring trafficking

    • Automated electrophysiology for functional modulators

    • In silico screening based on channel structural models

The discovery that acetazolamide can reduce paroxysmal ataxia exacerbations in patients with the V374A variant provides direct evidence that therapeutic intervention is possible for KCND3-related channelopathies .

What controls are essential for validating recombinant KCND3 experiments?

Robust experimental design for recombinant KCND3 studies requires comprehensive controls:

  • Expression controls:

    • Wild-type KCND3 (positive control)

    • Empty vector (negative control)

    • Known trafficking-deficient mutant (e.g., T352P)

    • Known functionally-impaired but trafficking-competent mutant (e.g., V374A)

    • GFP/reporter-only construct to assess transfection efficiency

  • Functional controls:

    • KChIP2 co-expression and no co-expression conditions

    • Standardized voltage protocols to allow comparison between studies

    • Pharmacological controls (e.g., 4-aminopyridine as Kv4.3 blocker)

    • Temperature controls (recording at both room temperature and physiological temperature)

  • Quantitative controls:

    • Dose-response relationships for expression plasmids

    • Internal standards for Western blot quantification

    • Calibration standards for fluorescence quantification

    • Time-course experiments to account for expression dynamics

  • Data analysis controls:

    • Blinded analysis of electrophysiological recordings

    • Automated and manual analysis comparisons

    • Statistical power calculations to determine appropriate sample sizes

Published studies demonstrate that these controls can distinguish between different mechanisms of channel dysfunction, as seen in comparative analyses of multiple SCA19/22-associated variants .

What are the critical parameters for electrophysiological characterization of recombinant KCND3?

Comprehensive electrophysiological characterization of recombinant KCND3 requires attention to several critical parameters:

  • Voltage protocols:

    • Activation: Holding at -90 mV, depolarizing steps from -80 to +60 mV in 10 mV increments

    • Steady-state inactivation: Pre-pulses from -120 to +30 mV, followed by test pulse to +40 mV

    • Recovery from inactivation: Paired-pulse protocol with variable inter-pulse intervals

    • Repetitive stimulation: Trains of depolarizing pulses at physiologically relevant frequencies

  • Recording conditions:

    • Physiological solutions approximating intracellular and extracellular ion concentrations

    • Temperature control (room temperature vs. physiological temperature)

    • Consistent timing post-transfection (typically 24-48 hours)

    • Cell capacitance measurement for current density normalization

  • Data analysis parameters:

    • Peak current amplitude and density (pA/pF)

    • Activation and inactivation time constants (τact, τinact)

    • Voltage dependence of activation and inactivation (V½, slope factor)

    • Recovery from inactivation time course

    • Use of multi-exponential fitting for complex kinetics

  • Technical considerations:

    • Series resistance compensation (≥80%)

    • Adequate voltage clamp, particularly for large currents

    • Leak subtraction protocols

    • Junction potential correction

These parameters allow for detection of subtle functional differences between wild-type and mutant channels. For example, the V374A variant was found to reduce current amplitude without altering gating properties, while some cardiac-associated variants show both increased amplitude and altered kinetics .

How can researchers optimize co-expression studies with KChIP2 and other regulatory proteins?

Optimization of co-expression studies requires careful consideration of several factors:

  • Expression vector design:

    • Bicistronic vectors (e.g., pIRES2) allow coordinated expression of multiple proteins

    • Different fluorescent tags for each construct (e.g., EGFP for KCND3, dsRed2 for KChIP2) enable identification of co-transfected cells

    • Standardized promoters ensure consistent expression ratios

  • Expression ratio optimization:

    • Titration experiments with varying ratios of Kv4.3:KChIP2 (1:1, 1:2, 1:4)

    • Quantification of protein expression by Western blot

    • Correlation of expression ratio with functional outcomes

  • Temporal considerations:

    • KChIP2 may require pre-expression before KCND3 for optimal effects

    • Time-course experiments to determine optimal expression window

    • Extended culture periods for trafficking-deficient mutants

  • Additional regulatory proteins:

    • DPP6/DPPX and DPP10 modulate Kv4.3 gating and trafficking

    • Kv β subunits can alter channel properties

    • Consideration of cell-type specific auxiliary subunits

  • Control experiments:

    • KChIP2 expression alone to rule out endogenous Kv4 activation

    • Dominant-negative KChIP2 constructs as negative controls

    • Calcium chelation to assess calcium-dependent KChIP2 effects

Research has demonstrated that KChIP2 co-expression can significantly attenuate dysfunction caused by certain KCND3 mutations, highlighting the importance of optimizing these co-expression systems. For instance, the T352P variant shows reduced dysfunction when co-expressed with KChIP2, suggesting therapeutic potential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.