Recombinant Rabbit Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)

Shipped with Ice Packs
In Stock

Description

Recombinant KCNQ1 Applications in Research

Recombinant KCNQ1 is used to study channel biophysics, trafficking, and disease mechanisms.

Experimental Uses

ApplicationPurposeSource
ElectrophysiologyAnalyzing gating kinetics, modulation by KCNE subunits, and mutant effects
Trafficking StudiesInvestigating supertrafficking mutants (e.g., R231C) linked to arrhythmias
Protein InteractionsMapping binding sites for KCNE1 and structural determinants of channel assembly

Disease Associations and Mutant Phenotypes

KCNQ1 mutations underlie cardiac arrhythmias (e.g., long QT syndrome type 1, LQT1) and sensorineural deafness .

Notable Mutants

MutationPhenotypeMechanismSource
R231CConstitutive channel activity; reduced single-channel conductance (~20% of WT) Supertrafficking, altered gating
V129AEnhanced surface trafficking; gain-of-function (GOF) arrhythmia riskDisrupted intracellular retention
LQTS1-linked mutantsLoss-of-function (LOF); prolonged action potential durationMisfolding, mistrafficking

Gene Therapy Advances

A suppression-replacement (SupRep) gene therapy approach has shown promise in rescuing LQT1 in transgenic rabbits .

Therapeutic Strategy

ComponentRoleOutcome
KCNQ1 shRNASilences endogenous mutant KCNQ1 mRNAReduces dominant-negative effects
shRNA-immune KCNQ1 cDNARestores WT channel expressionNormalizes action potential duration
AAV9 DeliveryTargets cardiac tissue via intra-aortic root injection~WT-level QT index in treated rabbits

Results:

  • QT Index: Shortened to near WT levels in treated LQT1 rabbits .

  • Action Potential Duration (APD): Reduced to WT-like levels under β-adrenergic stress .

Research Challenges and Future Directions

  1. Structural Resolution: High-resolution models of KCNQ1/KCNE1 complexes remain limited .

  2. Therapeutic Translation: Scaling SupRep therapy to human trials requires optimizing delivery and long-term safety .

  3. Epithelial Roles: KCNQ1’s role in salt/water transport (e.g., kidney, intestine) warrants deeper exploration .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. If you have specific format requirements, kindly include them in your order remarks, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Our standard shipping procedure utilizes normal blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
KCNQ1; KVLQT1; Potassium voltage-gated channel subfamily KQT member 1; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; KQT-like 1; Voltage-gated potassium channel subunit Kv7.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
KCNQ1
Target Protein Sequence
ATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASMV VLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFL GLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWG
Uniprot No.

Target Background

Function
Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1) is a potassium channel that plays a vital role in various tissues, including the heart, inner ear, stomach, and colon. It associates with KCNE beta subunits, which modulate current kinetics. KCNQ1 induces a voltage-dependent potassium-selective outward current characterized by rapid activation and slow deactivation. It also promotes a delayed voltage-activated potassium current exhibiting outward rectification. During beta-adrenergic receptor stimulation, KCNQ1 participates in cardiac repolarization by associating with KCNE1 to form the I(Ks) cardiac potassium current. This association increases the amplitude and slows down the activation kinetics of outward potassium current I(Ks). The muscarinic agonist oxotremorine-M significantly suppresses KCNQ1/KCNE1 current. When associated with KCNE3, KCNQ1 forms the potassium channel crucial for cyclic AMP-stimulated intestinal secretion of chloride ions. This interaction with KCNE3 is reduced by 17beta-estradiol, resulting in a decrease in currents. Under conditions of increased substrate load, KCNQ1 maintains the driving force for proximal tubular and intestinal sodium ions absorption, gastric acid secretion, and cAMP-induced jejunal chloride ions secretion. It facilitates the provision of potassium ions to the luminal membrane of the secretory canaliculus in the resting state, as well as during stimulated acid secretion. When associated with KCNE2, KCNQ1 forms a heterooligomer complex, resulting in currents with apparently instantaneous activation, rapid deactivation, a linear current-voltage relationship, and a decrease in the amplitude of the outward current. When associated with KCNE4, KCNQ1 inhibits voltage-gated potassium channel activity. When associated with KCNE5, the complex only conducts current upon sustained and strong depolarization. KCNQ1 also forms a heterotetramer with KCNQ5, exhibiting voltage-gated potassium channel activity. KCNQ1 binds with phosphatidylinositol 4,5-bisphosphate.
Database Links
Protein Families
Potassium channel family, KQT (TC 1.A.1.15) subfamily, Kv7.1/KCNQ1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Early endosome. Membrane raft. Endoplasmic reticulum. Basolateral cell membrane.

Q&A

What is KCNQ1 and what role does it play in cardiac electrophysiology?

KCNQ1 encodes the Kv7.1 potassium channel that forms a critical component of the delayed rectifier potassium current in cardiac myocytes. The channel plays an essential role in cardiac action potential repolarization. Pathogenic variants in KCNQ1 cause Type 1 Long QT Syndrome (LQT1), characterized by prolonged ventricular action potential duration (APD) . KCNQ1, together with its β subunit KCNE1, forms the slow component of the delayed rectifier K+ current (IKs) . This current is crucial for maintaining proper cardiac rhythm, particularly during β-adrenergic stimulation, and mutations affecting channel function can lead to potentially fatal cardiac arrhythmias.

How are transgenic LQT1 rabbit models developed and validated?

Transgenic LQT1 rabbit models are developed by introducing specific pathogenic variants of the KCNQ1 gene into rabbit embryos. These models serve as valuable platforms for testing gene therapies and understanding LQT1 pathophysiology. Validation typically involves:

  • Electrocardiographic assessment: 12-lead ECGs to confirm prolonged QT intervals

  • Cellular electrophysiology: Patch-clamp experiments on isolated ventricular cardiomyocytes to verify prolonged action potential duration

  • Response to β-adrenergic stimulation: Testing with agents like isoproterenol to assess QT interval and APD90 behavior under sympathetic stimulation

These models are critical for pre-clinical testing of therapeutic approaches as they recapitulate the human disease phenotype more accurately than mouse models due to similarities in cardiac electrophysiology between rabbits and humans.

What methods are commonly used to measure KCNQ1 function in experimental settings?

Several experimental techniques are employed to assess KCNQ1 function:

TechniqueParameters MeasuredApplications
Patch-clamp electrophysiologyAction potential duration (APD), Current density, Channel kineticsFunctional assessment of ion channel properties
12-lead ECGQT interval, QT index (QTi)In vivo cardiac electrical activity
Cell surface biotinylationSurface expression levelsTrafficking efficiency analysis
ImmunofluorescenceCellular localizationSubcellular distribution patterns
Co-immunoprecipitationProtein-protein interactionsStudy of channel complex formation

Patch-clamp experiments on isolated ventricular cardiomyocytes are particularly valuable as they allow direct measurement of action potential characteristics and channel currents . For quantitative assessment of trafficking efficiency, researchers often calculate the ratio of surface KCNQ1 to total cellular KCNQ1 expression, typically expressed as a percentage .

How does the unique intermediate conductance state of KCNQ1 influence experimental design?

KCNQ1 possesses a distinctive intermediate conductance state that presents both challenges and opportunities for researchers. Unlike other Kv channels such as Shaker that only conduct current when their voltage sensor domains (VSDs) are in the activated state, KCNQ1 demonstrates ionic current in the intermediate state .

This unique property enables functional electrophysiological discrimination between different conformational states of the channel that would be impossible with other potassium channels. When designing experiments, researchers can leverage this characteristic to:

  • Distinguish between intermediate and activated states through functional measurements

  • Validate structural models using electrophysiological signatures

  • Study state-dependent pharmacology and auxiliary subunit regulation

As noted in structural studies: "KCNQ1 represents a particularly suitable platform for structure-function study of the intermediate state in KV VSDs" . This property has been utilized to validate experimental three-dimensional structures of human KCNQ1 VSD through functional electrophysiology evidence based on KCNE1 regulation and XE991 pharmacology.

What mechanisms underlie KCNQ1 trafficking, and how do disease-associated mutations affect this process?

KCNQ1 trafficking involves complex cellular processes that transport the channel from synthesis sites to the plasma membrane. Disease-associated mutations can dramatically alter trafficking efficiency:

Loss-of-function (LOF) mutations in LQTS1 often reduce surface channel levels, while some gain-of-function (GOF) mutations exhibit enhanced trafficking. A comprehensive analysis of disease-linked GOF mutants revealed approximately half demonstrate "supertrafficking" - trafficking more efficiently to the cell surface than wild-type KCNQ1 .

The R231C mutation represents an extreme case of supertrafficking, showing:

  • 500% higher surface expression than wild-type KCNQ1

  • 1.7-fold higher total expression

  • 3-fold greater surface-trafficking efficiency

At the molecular level, trafficking efficiency depends on:

  • Energetic coupling between specific amino acid residues (e.g., R231C, F166, V129)

  • Proper folding of the voltage-sensor domain

  • Interactions with auxiliary proteins

  • Total cellular expression levels (trafficking efficiency typically decreases with higher expression levels)

These findings suggest that rational design approaches targeting trafficking pathways could provide novel therapeutic strategies for KCNQ1-related channelopathies.

What are the current gene therapy approaches for KCNQ1-related disorders?

Recent advances in gene therapy for KCNQ1-related disorders, particularly LQT1, focus on suppression-replacement (SupRep) strategies. This innovative approach combines:

  • KCNQ1 shRNA for suppression of mutant alleles

  • shRNA-immune KCNQ1 cDNA for replacement with functional channels

The therapy is packaged into adeno-associated virus serotype 9 (AAV9) vectors and has been tested in transgenic LQT1 rabbit models via intra-aortic root injection at a dose of 1E10 vg/kg. Results demonstrated:

  • Significant shortening of pathologically prolonged QT index (QTi) toward wild-type levels

  • Pronounced shortening of action potential duration in ventricular cardiomyocytes

  • Normalization of response to β-adrenergic stimulation with isoproterenol

This represents the first animal-model, proof-of-concept gene therapy for LQT1. Further development aims to achieve similar QT/APD correction with intravenous administration, which would be more clinically feasible for human patients .

How do interactions between KCNQ1 and HERG influence cardiac ion channel research?

KCNQ1 and HERG (encoded by KCNH2) form the slow (IKs) and rapid (IKr) components of the delayed rectifier potassium current, respectively. Research has revealed significant functional interdependence between these channels that impacts experimental design and interpretation:

  • Co-expression effects: KCNQ1 co-expression with HERG in cultured cells increases IHERG density

  • Biochemical interaction: The proteins co-immunoprecipitate and co-localize in cardiac myocytes

  • Trafficking interdependence: Trafficking-competent KCNQ1 enhances membrane expression of HERG

  • Mutation-specific effects: KCNQ1 variably modulates LQTS2 mutations with distinct underlying pathologies

Experimental evidence demonstrates that while wild-type KCNQ1 approximately doubles HERG tail current density, trafficking-defective KCNQ1 variants (like T587M) fail to enhance HERG function . This dependency has important implications for understanding polygenic contributions to arrhythmia susceptibility and for developing comprehensive therapeutic approaches.

What are the optimal methods for measuring KCNQ1 surface expression in experimental systems?

Quantitative assessment of KCNQ1 surface expression is crucial for trafficking studies and can be achieved through several complementary approaches:

  • Cell surface biotinylation: This biochemical approach uses membrane-impermeable biotinylation reagents followed by streptavidin pull-down to isolate surface proteins. Quantification is performed by:

    • Western blotting with KCNQ1-specific antibodies

    • Calculating the ratio [(level of KCNQ1 at surface)/(total cellular KCNQ1)] × 100

  • Flow cytometry: Using extracellular epitope-tagged KCNQ1 constructs for high-throughput analysis

  • Immunofluorescence microscopy: For visualization of subcellular localization with quantitative analysis:

    • Confocal imaging with membrane markers

    • Statistical analysis of fluorescence intensity at membrane versus cytoplasmic regions

    • Single-cell analysis to account for expression level variation

When analyzing trafficking efficiency, it's important to consider the relationship between total expression and trafficking efficiency. Research has shown that in both wild-type and mutant KCNQ1 (e.g., R231C), single-cell trafficking efficiency is inversely proportional to total cellular expression, though this relationship varies between different channel variants .

How can KCNQ1 suppression-replacement gene therapy vectors be optimized?

Optimization of KCNQ1 SupRep gene therapy vectors requires careful consideration of multiple components:

  • shRNA design:

    • Target sequences unique to the mutant allele when possible

    • Ensure high suppression efficiency (>80%) of target KCNQ1

    • Minimize off-target effects through bioinformatic screening

  • Replacement cDNA optimization:

    • Introduce silent mutations to create shRNA immunity

    • Codon optimization for expression in cardiac tissue

    • Inclusion of cardiac-specific promoters for targeted expression

  • Vector selection:

    • AAV9 demonstrates cardiac tropism and has been successfully used for KCNQ1 delivery

    • Consider vector capacity limitations (~4.7kb for AAV)

    • Balance between vector dose and potential immunogenicity

  • Delivery route optimization:

    • Intra-aortic root injection has demonstrated efficacy (1E10 vg/kg)

    • Exploration of intravenous administration for clinical translation

    • Evaluation of cardiac-targeted delivery approaches

Recent studies using these approaches have successfully normalized QTi and APD90 to near wild-type levels in transgenic LQT1 rabbits, both at baseline and after β-adrenergic stimulation with isoproterenol .

What patch-clamp protocols are most effective for characterizing KCNQ1 channel variants?

Effective characterization of KCNQ1 variants requires specialized patch-clamp protocols:

Protocol TypeParametersKey Applications
Activation protocolStep depolarizations from -80mV to +40mVDetermine voltage-dependence of activation (V₁/₂) and slope factors
Deactivation protocolRepolarization to negative potentials following activationMeasure deactivation kinetics and tail currents
β-adrenergic responseApplication of isoproterenol (100nM)Assess physiological response to sympathetic stimulation
Drug sensitivityApplication of specific inhibitors (e.g., XE991)Evaluate pharmacological properties and state-dependent binding

For comprehensive characterization, researchers should:

  • Record both whole-cell currents and action potentials in isolated cardiomyocytes

  • Measure action potential duration at 90% repolarization (APD90) as a key parameter

  • Assess channel function both at baseline and under β-adrenergic stimulation

  • Analyze data using normalized current-voltage relationships to determine activation parameters

When studying intermediate conductance states, special attention should be paid to KCNE1 co-expression effects and pharmacological responses, as these can discriminate between different conformational states of the voltage sensor domain .

How can the interaction between KCNQ1 and auxiliary proteins be effectively studied?

Investigating interactions between KCNQ1 and auxiliary proteins (particularly KCNE1 and HERG) requires multiple complementary approaches:

  • Co-expression studies in heterologous systems:

    • Transfection of CHO or HEK293 cells with controlled ratios of KCNQ1 and interacting proteins

    • Electrophysiological recording to assess functional modulation

    • Comparison of wild-type and mutant variants to identify interaction-dependent effects

  • Biochemical interaction assays:

    • Co-immunoprecipitation to detect physical association

    • Proximity ligation assays for in situ detection of protein interactions

    • FRET or BRET approaches to measure interaction dynamics in living cells

  • Structural studies:

    • Cryo-EM or NMR analysis of protein complexes

    • Mutational analysis of putative interaction domains

    • Energetic coupling analysis using double-mutant cycle approaches

  • Functional validation using:

    • Correlation between biochemical association and functional modulation

    • State-dependent effects (e.g., KCNE1 suppression of intermediate state)

    • Trafficking interdependence (e.g., KCNQ1 enhancement of HERG surface expression)

When investigating KCNQ1-HERG interactions specifically, researchers should note that trafficking-competent KCNQ1 can rescue some HERG variants (e.g., M124T) but has limited effects on others (e.g., G628S), indicating mutation-specific mechanisms .

What control conditions are essential for KCNQ1 gene therapy experiments in animal models?

Rigorous experimental design for KCNQ1 gene therapy studies requires several essential controls:

  • Genetic controls:

    • Wild-type (WT) rabbits without LQT1 mutations

    • Untreated LQT1 rabbits (LQT1-UT)

    • LQT1 rabbits treated with non-therapeutic vector (e.g., GFP)

  • Treatment variables:

    • Dose-response relationships (vector concentration)

    • Delivery route comparison (intra-aortic vs. intravenous)

    • Timing of treatment relative to disease progression

  • Outcome measurements:

    • Electrocardiographic parameters (QT interval, QTi)

    • Cellular electrophysiology (APD90)

    • Response to β-adrenergic stimulation (isoproterenol challenge)

    • Long-term follow-up for durability of effect and safety assessment

Recent proof-of-concept studies demonstrated significant efficacy using these controls, with KCNQ1-SupRep treatment normalizing the clinical QTi and cellular APD90 to near WT levels both at baseline and after isoproterenol .

How should researchers account for KCNQ1 trafficking variations when interpreting experimental data?

Trafficking variations in KCNQ1 can significantly impact experimental results and should be carefully considered:

  • Expression level dependencies:

    • Single-cell trafficking efficiency is inversely proportional to total expression

    • This relationship differs between wild-type and mutant channels (e.g., R231C)

    • Data should be analyzed across multiple expression levels

  • Cell type considerations:

    • Trafficking machinery varies between heterologous systems and native cardiomyocytes

    • Results from CHO or HEK293 cells should be validated in cardiac cells when possible

  • Quantitative analysis approaches:

    • Report both absolute surface expression and trafficking efficiency

    • Consider binning data by expression level to reveal trafficking-expression relationships

    • Calculate the ratio [(surface KCNQ1)/(total KCNQ1)] × 100 for consistent comparisons

  • Technical variations:

    • Standardize surface labeling protocols

    • Include positive controls (known trafficking mutations)

    • Normalize trafficking data to account for experimental variability

Understanding these variables is particularly important when studying disease mutations, as different variants can exhibit trafficking efficiencies ranging from severely impaired to dramatically enhanced (e.g., R231C shows 500% of wild-type efficiency) .

How can contradictory results between KCNQ1 functional and trafficking studies be reconciled?

Contradictions between functional and trafficking studies of KCNQ1 can arise from several sources:

  • State-dependent effects:

    • KCNQ1's unique intermediate conductance state means function depends on conformational state

    • Auxiliary subunits like KCNE1 suppress intermediate state conductance, potentially masking function despite surface expression

  • Trafficking-function dissociation:

    • Some mutations alter gating without affecting trafficking

    • Others affect trafficking without altering intrinsic channel properties

    • Comprehensive analysis requires both surface expression and electrophysiological measurements

  • Experimental system variations:

    • Different cell types may process the same KCNQ1 variant differently

    • Temperature-dependent trafficking can affect in vitro versus in vivo results

    • Protein interactions present in native cardiomyocytes may be absent in heterologous systems

  • Reconciliation strategies:

    • Perform both functional and trafficking studies in the same experimental system

    • Assess surface-specific functionality through techniques that isolate membrane currents

    • Consider structure-function relationships in data interpretation

    • Investigate potential compensatory mechanisms that may mask functional defects

The case of KCNQ1-HERG interactions illustrates this complexity, as trafficking-competent KCNQ1 enhances some HERG variants but not others, suggesting context-dependent mechanisms .

What are the key challenges in translating rabbit KCNQ1 research to human applications?

Translating KCNQ1 research from rabbit models to human applications faces several challenges:

  • Species-specific differences:

    • Despite similarities, rabbit and human cardiac electrophysiology are not identical

    • Protein sequence variations may affect drug responses and protein-protein interactions

    • Different regulatory mechanisms may influence gene therapy efficacy

  • Delivery challenges:

    • Intra-aortic root injection used in rabbit studies is highly invasive for humans

    • Intravenous administration requires higher vector doses with potential immunogenicity

    • Cardiac-specific targeting remains a challenge for systemic delivery

  • Genetic heterogeneity:

    • LQT1 patients have diverse mutations requiring personalized approaches

    • Some mutations may be more amenable to SupRep therapy than others

    • Allele-specific targeting may be necessary for dominant-negative mutations

  • Translational considerations:

    • Need for long-term safety and efficacy data before human trials

    • Regulatory requirements for novel gene therapies

    • Development of clinically feasible delivery methods

Despite these challenges, recent advancements in KCNQ1-SupRep gene therapy in transgenic rabbits provide encouraging proof-of-concept data that should "compel continued development of this gene therapy for patients with LQT1" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.