Recombinant Rabbit Potassium voltage-gated channel subfamily S member 3 (KCNS3)

Shipped with Ice Packs
In Stock

Description

Key Production Methods

ParameterDetails
Host SystemE. coli (e.g., Cusabio CSB-CF871319RB) , Mammalian cells
PurificationAffinity chromatography using His/GST tags
Purity>90% (SDS-PAGE verified)

Cancer Biology

  • Silencing KCNS3 in HCT15 colorectal and A549 lung cancer cells reduces proliferation by 40–60% in vitro and inhibits xenograft tumor growth .

  • Mechanism: Regulates cell cycle progression (G1/S transition) independently of ion conduction .

Neurological Studies

  • KCNS3 mRNA is reduced in the prefrontal cortex of schizophrenia patients, implicating it in GABAergic neuron dysfunction .

Cardiovascular Research

  • Highly expressed in pulmonary artery smooth muscle cells, influencing vascular tone .

Transcriptional Regulation

  • Sp1 Binding: The KCNS3 promoter contains GC-boxes bound by transcription factor Sp1. Mithramycin A (Sp1 inhibitor) reduces KCNS3 expression by 70% .

Protein Interactions

Interacting PartnerRoleMethod of Detection
HSP90AB1Chaperone for channel assemblyYeast two-hybrid
Kv2.1 (KCNB1)Functional heteromer formationCo-IP, electrophysiology

Challenges and Limitations

  • Stoichiometry Control: Achieving consistent 3:1 Kv2.1:KCNS3 ratios in recombinant systems remains technically challenging .

  • Antibody Specificity: Some commercial antibodies show cross-reactivity with mouse/rat homologs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNS3; Potassium voltage-gated channel subfamily S member 3; Delayed-rectifier K(+ channel alpha subunit 3; Voltage-gated potassium channel subunit Kv9.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
KCNS3
Target Protein Sequence
MVFGEFFHRPGPDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR YQERKEENHEKDWDQKSNDVSTDTSFEESSVFEKELEKFDQLRFGQLRKKIWIRMENPAY CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR LVAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID VDQCSEDPPEKCPELPYFNIRDLYAQRVHAFITSLSSVGIVVSDPDSTDASSIEDNEDVY NTASLENCTAK
Uniprot No.

Target Background

Function
Potassium channel subunit incapable of forming functional channels independently. It forms functional heterotetrameric channels with KCNB1, modulating the activation and deactivation rates of KCNB1's delayed rectifier voltage-gated potassium channels. Heterotetrameric channels with KCNB1 exhibit increased current amplitude and a threshold for action potential activation shifted to more negative values in hypoxically treated pulmonary artery smooth muscle cells.
Database Links
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.3/KCNS3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNS3 and what is its functional role in potassium channels?

KCNS3 (Potassium voltage-gated channel subfamily S member 3), also known as Kv9.3, functions as a potassium channel regulatory subunit. It does not form functional channels on its own but modulates the delayed rectifier potassium channel activity of KCNB1 (Kv2.1). Specifically, KCNS3 slows down the deactivation and inactivation time constants when forming heterotetrameric channels with KCNB1 .

The functional significance of this modulatory role lies in the fine-tuning of neuronal excitability. By altering the kinetics of potassium currents, KCNS3-containing channels likely contribute to specialized firing patterns in neurons where they are expressed. This regulatory function represents an important mechanism for creating diversity in potassium channel properties beyond what could be achieved with homomeric channels alone.

How does KCNS3 expression vary across brain regions and cell types?

KCNS3 shows differential expression across brain regions, with notable presence in the prefrontal cortex. Studies using in situ hybridization have successfully mapped KCNS3 mRNA expression in specific neuronal populations. Researchers classify neurons as KCNS3 mRNA-expressing when the grain number per neuron is at least five times the background number, as determined by counting grains over glial nuclei .

Of particular interest is the expression of KCNS3 in neurons labeled with Vicia villosa agglutinin (VVA), which is a selective marker for parvalbumin-positive inhibitory interneurons . These interneurons are critical for generating gamma oscillations that support cognitive functions often impaired in schizophrenia. The selective expression pattern of KCNS3 suggests its specialized role in particular neural circuits rather than a ubiquitous function throughout the brain.

What are the best methods for detecting endogenous KCNS3 in neural tissue?

Multiple validated methods exist for detecting KCNS3 in neural tissue:

  • In situ hybridization: This technique effectively detects KCNS3 mRNA using 35S-labeled riboprobes. The protocol involves exposing hybridized sections to autoradiographic films, coating with nuclear emulsion, development, and counterstaining with cresyl violet .

  • Immunohistochemistry: Rabbit polyclonal antibodies against KCNS3, such as ab230343, are suitable for immunohistochemistry on paraffin-embedded sections (IHC-P) in mouse and human samples .

  • Western blotting: The same rabbit polyclonal antibodies can detect KCNS3 protein via Western blotting in mouse and human samples, with antibodies targeting recombinant fragment proteins within the first 200 amino acids of human KCNS3 .

  • Single-cell analysis: Microarray analysis of individually dissected neurons labeled with specific markers represents an advanced approach for analyzing KCNS3 expression at the cellular level .

Why use rabbit-derived KCNS3 over other species for research applications?

Rabbit-derived proteins, including KCNS3, offer several notable advantages over those from other species:

  • Unique B-cell development: Rabbits have distinctive antibody repertoires resulting from their unique B-cell ontogeny, producing highly diverse, high-affinity, and specific antibodies .

  • Structural advantages: Rabbit HCDR3s (complementarity-determining region 3 of heavy chains) share more similarity with human HCDR3s than mouse HCDR3s, with mean lengths of 15±4 amino acids in rabbits and humans compared to 11±2 in mice. This similarity enhances translational potential .

  • Light chain diversity: Rabbits compensate for limited heavy-chain usage with remarkably diverse light chains. Rabbit LCDR3s are longer (12±2 amino acids) compared to mouse and human (9±1 amino acids) and are occasionally stabilized by disulfide bridges .

  • Dominant light chain recognition: Crystal structures of rabbit antibodies frequently reveal a dominant role for LCDR3 in antigen binding, which may offer unique recognition properties for complex epitopes on KCNS3 .

These characteristics make rabbit-derived KCNS3 particularly valuable for generating research tools with high specificity and affinity.

What expression systems are optimal for producing recombinant rabbit KCNS3?

While the search results don't specifically address expression systems for rabbit KCNS3, based on general principles for recombinant potassium channel proteins and rabbit antibody production methods, several approaches can be recommended:

  • Mammalian expression systems: HEK293 or CHO cells typically provide proper post-translational modifications and folding for membrane proteins like KCNS3.

  • Baculovirus-insect cell systems: These offer higher yield than mammalian systems while maintaining most post-translational modifications.

  • Cell-free systems: For applications requiring rapid expression, though with potential limitations for membrane proteins.

The choice of expression system should consider the intended application, whether structural studies, functional assays, or antibody production. For electrophysiological studies of KCNS3-KCNB1 interactions, co-expression in mammalian cells would likely provide the most physiologically relevant results.

How can researchers effectively generate antibodies against rabbit KCNS3?

Based on established methods for rabbit antibody production described in the search results, researchers can employ several strategies to generate antibodies against rabbit KCNS3:

  • Hybridoma technology: This traditional approach can be adapted for generating monoclonal antibodies against KCNS3 .

  • Phage display: This technique has proven successful for rabbit antibody production. The chimeric rabbit/human Fab format is recommended for phage display applications requiring high-affinity antibodies .

  • Single-domain antibody engineering: VL or VH domains can be engineered from rabbit antibodies, potentially offering advantages for recognizing cryptic epitopes on KCNS3 .

When selecting immunogens, researchers should consider using recombinant fragments of KCNS3, similar to the approach used for commercial antibodies that target the first 200 amino acids of the protein .

How is KCNS3 expression altered in schizophrenia?

Multiple lines of evidence demonstrate altered KCNS3 expression in schizophrenia:

Measurement MethodBrain RegionChange in SchizophreniaStudy Details
In situ hybridization (film optical density)Prefrontal cortex23% lower22 matched pairs
Density of KCNS3 mRNA-expressing neuronsPrefrontal cortexSignificantly lower22 matched pairs
KCNS3 mRNA level per neuronPrefrontal cortexSignificantly lower22 matched pairs
Microarray analysis of VVA-labeled neuronsPrefrontal cortex40% lower14 matched pairs

Importantly, KCNS3 mRNA levels were not altered in antipsychotic-exposed monkeys, suggesting that the observed reductions in schizophrenia are likely not medication-induced artifacts . These findings indicate that KCNS3 dysfunction may represent a genuine disease-related alteration.

What experimental designs best reveal KCNS3's role in neural excitability?

Optimal experimental designs for investigating KCNS3's role in neural excitability include:

  • Patch-clamp electrophysiology: Recording from neurons with defined KCNS3 expression levels can directly measure its effects on action potential characteristics and firing patterns.

  • Co-expression studies: Expressing KCNS3 with KCNB1 in heterologous systems allows precise quantification of how KCNS3 modulates channel kinetics, including deactivation and inactivation time constants .

  • Calcium imaging: This approach can assess network-level consequences of altered KCNS3 expression, particularly in relation to oscillatory activities.

  • In vivo approaches: Selective manipulation of KCNS3 in specific neuron populations (e.g., parvalbumin-positive interneurons) can reveal its contribution to circuit function and behavior.

When designing these experiments, researchers should carefully control for potential confounds, such as compensatory changes in other ion channels and developmental effects of chronic KCNS3 alterations.

How should in situ hybridization protocols be optimized for KCNS3 detection?

Based on published methods , optimal in situ hybridization for KCNS3 mRNA detection should incorporate:

  • Riboprobe design: Use riboprobes specific to KCNS3 mRNA labeled with 35S-CTP. The specificity should be validated in preliminary studies .

  • Sampling strategy: Count labeled signals in emulsion-coated sections using sampling frames systematically and randomly placed in the region of interest (e.g., gray matter of prefrontal cortex area 9) .

  • Threshold determination: Consider neurons as specifically labeled (KCNS3 mRNA-expressing) when the grain number per neuron is at least five times the background number, determined by counting grains over glial nuclei .

  • Technical controls: Process sections in a pairwise manner throughout the hybridization procedures and subsequent signal detection to minimize technical variability .

  • Covariate analysis: Conduct analyses of covariance (ANCOVA) to account for potential confounding variables including age, postmortem interval, brain pH, RNA integrity number (RIN), and storage time, as these have been shown to affect measurements .

How do KCNS3-KCNB1 interactions affect neuronal network activity?

The functional consequences of KCNS3-KCNB1 interactions for neuronal network activity represent an advanced research question with implications for understanding both normal brain function and pathological states like schizophrenia.

KCNS3 modulates KCNB1 channel kinetics by slowing down deactivation and inactivation time constants . These alterations likely affect:

  • Action potential repolarization: Modified potassium currents may alter action potential shape and after-hyperpolarization.

  • Firing frequency: Changes in channel kinetics could impact maximum firing rates and adaptation properties.

  • Network synchronization: In parvalbumin-positive interneurons, where KCNS3 is expressed and which are critical for generating gamma oscillations, altered KCNS3 function may disrupt the precise timing of inhibition necessary for network synchrony.

  • Excitation-inhibition balance: Dysregulated KCNS3 function specifically in inhibitory interneurons could alter the excitation-inhibition balance in cortical circuits.

Research examining these network effects would benefit from combining cellular electrophysiology with network-level recordings and computational modeling.

What statistical considerations are critical when analyzing KCNS3 expression data?

Analysis of KCNS3 expression data requires careful statistical approaches:

  • Covariate analysis: ANCOVA should be used to adjust for confounding variables. Studies have shown that KCNS3 expression measures can be significantly affected by age, RNA integrity (RIN), and sample storage time .

  • Paired designs: Utilizing matched pairs of subjects (e.g., schizophrenia and comparison subjects matched for sex and age) increases statistical power and controls for demographic variables .

  • Appropriate transformations: Consider log2-transformation of expression signals for microarray data to normalize distribution .

  • Multiple sampling: Average data across multiple tissue sections (e.g., three sections) for each subject before statistical analyses to enhance reliability .

  • Correlation analyses: Use Pearson's correlation to assess relationships between KCNS3 and other genes of interest (e.g., KCNB1), both in terms of raw expression values and disease-related changes .

How can CRISPR-Cas9 technology be applied to study KCNS3 function?

CRISPR-Cas9 technology offers powerful approaches for investigating KCNS3 function:

  • Knockout models: Generation of KCNS3 knockout cellular or animal models to assess its role in channel function and neuronal excitability.

  • Knock-in strategies: Introduction of tagged versions of KCNS3 for visualization or reporter-based studies of expression and trafficking.

  • Point mutations: Introduction of specific mutations to assess structure-function relationships or to recreate variants of interest.

  • Cell-type specific manipulation: Combining CRISPR with cell-type specific promoters allows selective manipulation of KCNS3 in particular neuron populations, such as parvalbumin-positive interneurons.

  • Inducible systems: Temporal control of KCNS3 expression or knockout can distinguish developmental from acute roles.

When designing CRISPR experiments for KCNS3, researchers should carefully validate guide RNA specificity and efficiency, and consider potential off-target effects and compensatory mechanisms.

How do rabbit antibody properties compare to other species for KCNS3 research?

The unique properties of rabbit antibodies make them particularly valuable for KCNS3 research:

CharacteristicRabbitMouseHumanResearch Implications
Mean HCDR3 length15±4 aa (mode=13)11±2 aa (mode=10)15±4 aa (mode=15)Rabbit antibodies more closely match human antibody structure
Mean LCDR3 length12±2 aa (mode=12)9±1 aa (mode=9)9±1 aa (mode=9)Longer LCDR3s may provide better recognition of complex KCNS3 epitopes
LCDR3 stabilizationOccasional disulfide bridgesRareRareEnhanced stability for long-term applications
Light chain dominanceCommonLess commonLess commonPotentially more effective for certain KCNS3 epitopes
Diversity mechanismsLimited heavy chain usage compensated by diverse light chainsMore balancedMore balancedDifferent pattern of epitope recognition

These characteristics suggest that rabbit-derived antibodies against KCNS3 may offer superior recognition properties for certain applications, particularly where high specificity and affinity are required.

What are the key methodological considerations when studying KCNS3 in disease models?

When investigating KCNS3 in disease models, researchers should consider:

  • Medication effects: Studies of KCNS3 in psychiatric disorders should control for medication effects. Research has shown that KCNS3 mRNA levels were not altered in antipsychotic-exposed monkeys, suggesting disease-specific rather than medication-induced changes .

  • Cell-type specificity: Given KCNS3's differential expression across cell types, analyses should consider cell-type specific changes. Methods like laser-capture microdissection or single-cell approaches can provide this resolution .

  • Regional specificity: KCNS3 expression and function may vary across brain regions, requiring careful anatomical precision in sampling.

  • Developmental timing: Consider potential developmental changes in KCNS3 expression and function, which may differ between normal and disease states.

  • Translation between models: When translating findings between species or between in vitro and in vivo models, consider potential differences in KCNS3 expression patterns, regulation, and interaction partners.

What emerging technologies hold promise for KCNS3 research?

Several emerging technologies offer new opportunities for advancing KCNS3 research:

  • Single-cell transcriptomics: Provides unprecedented resolution of cell-type specific expression patterns and potential co-expression with interaction partners.

  • Super-resolution microscopy: Enables detailed visualization of KCNS3 subcellular localization and co-localization with KCNB1 and other proteins.

  • Optogenetic and chemogenetic approaches: Allow temporal control of KCNS3-expressing neurons to assess their circuit contributions.

  • In vivo calcium imaging: Permits assessment of activity patterns in KCNS3-expressing neurons in behaving animals.

  • Cryo-EM and structural biology: May provide detailed structural information about KCNS3-KCNB1 interactions, potentially informing drug development targeting these complexes.

  • Human stem cell-derived neurons: Enable investigation of KCNS3 function in human neurons, including those derived from patients with schizophrenia or other relevant disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.