Recombinant Rabbit Substance-K receptor (TACR2)

Shipped with Ice Packs
In Stock

Description

Introduction to Substance-K Receptor (TACR2)

Substance-K receptor, scientifically designated as TACR2, is a protein encoded by the TACR2 gene in mammals. This receptor specifically binds to the tachykinin neuropeptide substance K, also known as neurokinin A. The receptor functions as part of the tachykinin receptor family and plays crucial roles in various physiological processes. TACR2 is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system, facilitating signal transduction across cell membranes . The receptor has several alternative nomenclatures in scientific literature, including NK2-R, NK2R, NKNAR, SKR, and TAC2R, all referring to the same molecular entity that functions as the neurokinin A receptor .

The general structure of TACR2 reflects its function as a transmembrane receptor, with multiple domains responsible for ligand binding, signal transduction, and cellular localization. Understanding the molecular characteristics of this receptor provides insights into its physiological roles and potential therapeutic applications in various neurological and inflammatory conditions.

Expression Systems and Production Methods

Recombinant Rabbit Substance-K receptor is produced using various expression systems, each offering distinct advantages for different research applications. The most common production method utilizes in vitro Escherichia coli expression systems, which provide high yields of recombinant protein suitable for multiple research applications . Alternative expression platforms include yeast-based systems, baculovirus-infected insect cells, mammalian cell culture systems, and in vivo biotinylation approaches in E. coli .

Each expression system imparts specific post-translational modifications and folding characteristics to the recombinant protein, potentially affecting its structural integrity and functional properties. The selection of an appropriate expression system depends on the intended research application, with mammalian cell-based production often preferred for studies requiring native-like receptor functionality and post-translational modifications.

Available Recombinant Rabbit TACR2 Products

Commercial suppliers offer various recombinant rabbit TACR2 products to meet diverse research needs. These products include both full-length and partial receptor proteins, each designed for specific experimental applications. Table 1 summarizes the available recombinant rabbit TACR2 products from one supplier:

Table 1: Commercially Available Recombinant Rabbit TACR2 Products

Product CodeProduct NameExpression System
CSB-CF023069RBRecombinant Rabbit Substance-K receptor (TACR2)in vitro E.coli expression system
CSB-YP023069RB1Recombinant Rabbit Substance-K receptor (TACR2), partialYeast
CSB-EP023069RB1Recombinant Rabbit Substance-K receptor (TACR2), partialE.coli
CSB-BP023069RB1Recombinant Rabbit Substance-K receptor (TACR2), partialBaculovirus
CSB-MP023069RB1Recombinant Rabbit Substance-K receptor (TACR2), partialMammalian cell
CSB-EP023069RB1-BRecombinant Rabbit Substance-K receptor (TACR2), partialIn Vivo Biotinylation in E.coli

These products provide researchers with options for selecting the most appropriate form of recombinant rabbit TACR2 based on their specific experimental requirements and downstream applications .

Immunological Studies and Antibody Development

Recombinant Rabbit Substance-K receptor serves as a crucial immunogen for developing antibodies against TACR2. These antibodies find applications in various immunological techniques, including Western blotting, immunohistochemistry, immunocytochemistry, and immunoprecipitation studies . The availability of recombinant rabbit TACR2 enables the production of species-specific antibodies that can be used to study receptor expression, localization, and regulation in rabbit tissues and cells.

The development of polyclonal and monoclonal antibodies against rabbit TACR2 relies on purified recombinant proteins as immunogens. These antibodies subsequently serve as essential tools for detecting endogenous TACR2 expression in experimental rabbit models, facilitating research on neurological and inflammatory processes mediated by tachykinin signaling.

Functional Studies and Drug Discovery

Recombinant TACR2 proteins provide valuable tools for studying receptor-ligand interactions, signal transduction mechanisms, and pharmacological modulation of receptor activity. The availability of purified recombinant rabbit TACR2 enables researchers to:

  1. Perform binding assays to characterize the interaction between the receptor and its natural ligands or synthetic modulators

  2. Investigate structure-function relationships through site-directed mutagenesis and functional assays

  3. Screen potential therapeutic compounds that target TACR2 for treating neurological or inflammatory conditions

  4. Study species-specific differences in receptor pharmacology and signaling

These functional studies contribute to our understanding of tachykinin signaling pathways and facilitate the development of novel therapeutic approaches targeting TACR2.

Species-Specific Research Models

Rabbit models serve important roles in various research areas, including cardiovascular disease, inflammation, and neurological disorders. The availability of recombinant rabbit TACR2 supports these research efforts by providing tools for studying tachykinin signaling in rabbit-based experimental systems.

The use of species-matched recombinant proteins enhances the relevance and reproducibility of research findings in animal models. Recombinant rabbit TACR2, in particular, enables more accurate characterization of tachykinin signaling in rabbit models, reducing potential artifacts associated with cross-species reactivity.

Quality Control and Validation

Commercial recombinant rabbit TACR2 products undergo rigorous quality control measures to ensure purity, activity, and batch-to-batch consistency. These measures typically include:

  1. Verification of protein identity through mass spectrometry or sequence analysis

  2. Assessment of purity using SDS-PAGE or HPLC techniques

  3. Functional validation through binding assays or activity measurements

  4. Testing for endotoxin contamination and other impurities

When selecting recombinant rabbit TACR2 for research applications, considering these quality parameters ensures the reliability and reproducibility of experimental results.

Future Perspectives and Emerging Applications

The continued development and refinement of recombinant rabbit TACR2 production methods are expected to enhance the availability and quality of these research tools. Emerging applications for recombinant rabbit TACR2 include:

  1. Development of high-throughput screening platforms for identifying novel TACR2 modulators

  2. Integration into microfluidic or organ-on-chip systems for studying tachykinin signaling in complex tissue environments

  3. Utilization in structural biology studies to determine the three-dimensional structure of rabbit TACR2

  4. Application in comparative pharmacology studies to guide the development of species-specific therapeutic approaches

These emerging applications highlight the ongoing importance of recombinant rabbit TACR2 as a valuable research tool in neurobiology, pharmacology, and drug discovery.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference for your preparation.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please let us know, and we will prioritize the development of that tag.
Synonyms
TACR2; TAC2R; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
MGACDIVTEANISSDIDSNATGVTAFSMPGWQLALWATAYLALVLVAVVGNATVIWIILA HRRMRTVTNYFIVNLALADLCMATFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSGPGTKAVIAGIWLVALALAFPQCFYSTITMDQGATK CVVAWPEDSGGKMLLLYHLTVIALIYFLPLVVMFVAYSVIGFKLWRRTVPGHQTHGANLR HLRAKKKFVKTMVLVVVTFAVCWLPYHLYFLLGHFQDDIYCRKFIQQVYLVLFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKLELTHTPSLSVRVNRCHTKETLFLV GDVAPSEAANGQAGGPQDGGAYDF
Uniprot No.

Target Background

Function
This receptor binds to the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Substance-K receptor (TACR2) and what is its primary function?

The Substance-K receptor, also known as TACR2 or NK2R, is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It belongs to the G protein-coupled receptor (GPCR) family, specifically within the tachykinin receptor subfamily. TACR2 is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system . The receptor's primary function involves mediating the biological effects of neurokinin A, including smooth muscle contraction, neuronal excitation, and inflammatory responses.

The receptor demonstrates a specific rank order of affinity for tachykinin peptides: substance K (neurokinin A) > neuromedin-K > substance P . This binding specificity determines its physiological role and pharmacological profile.

What is the molecular structure of rabbit TACR2?

Rabbit TACR2 exhibits the typical GPCR architecture with seven transmembrane domains (TM1-TM7) connected by alternating intracellular loops (ICL1-3) and extracellular loops (ECL1-3) . The protein begins with an N-terminal extracellular domain and concludes with a C-terminal intracellular domain. The amino acid sequence reveals conserved motifs characteristic of Class A GPCRs, particularly those in the tachykinin receptor family.

Key structural features include:

  • N-terminal domain consisting of approximately 30 amino acids

  • Seven hydrophobic transmembrane domains that anchor the receptor in the cell membrane

  • Three extracellular loops that contribute to ligand binding specificity

  • Three intracellular loops involved in G protein coupling and signal transduction

  • C-terminal domain involved in receptor regulation and trafficking

DomainApproximate PositionFunction
N-terminus1-31Extracellular domain involved in initial ligand recognition
TM132-61First transmembrane helix
ICL162-67First intracellular loop involved in G protein coupling
TM268-91Second transmembrane helix
ECL192-107First extracellular loop contributing to ligand specificity
TM3108-140Third transmembrane helix containing critical binding residues
ICL2141-150Second intracellular loop with G protein interface
TM4151-173Fourth transmembrane helix
ECL2174-191Second extracellular loop with disulfide bond
TM5192-221Fifth transmembrane helix involved in activation
ICL3222-244Third intracellular loop critical for signaling specificity
TM6245-271Sixth transmembrane helix with conformational changes upon activation
ECL3272-280Third extracellular loop
TM7281-305Seventh transmembrane helix containing NPxxY motif

What are the known synonyms and identifiers for rabbit TACR2?

When searching literature and databases, researchers should be aware of the various nomenclature used for rabbit TACR2. The following synonyms and identifiers are commonly used :

  • TACR2 (gene name)

  • TAC2R (alternative gene name)

  • NK2R (common abbreviation)

  • Neurokinin 2 receptor

  • NK-2 receptor

  • NK-2R

  • Neurokinin A receptor

  • Substance-K receptor

  • SK receptor

  • SKR

  • Substance K receptor

  • NKNAR

  • Tachykinin receptor 2

What expression systems are most effective for producing recombinant rabbit TACR2?

The choice of expression system for rabbit TACR2 significantly impacts protein yield, functionality, and post-translational modifications. Based on research practices with similar GPCRs, the following expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
Mammalian cells (HEK293, CHO)- Native-like post-translational modifications
- Proper folding and trafficking
- Suitable for functional studies
- Lower yields
- Higher cost
- Longer production time
Functional assays, binding studies, structural biology with stabilized constructs
Insect cells (Sf9, High Five)- Higher expression levels than mammalian cells
- Some post-translational modifications
- Cost-effective for scaling
- Differences in glycosylation
- May affect certain functional properties
Structural studies, purification for antibody generation, large-scale protein production
Yeast (Pichia pastoris)- High density cultures
- Cost-effective
- Some post-translational modifications
- Potential hypermannosylation
- Different membrane composition
Mutational analysis, purification for structural studies
Cell-free systems- Rapid production
- Avoids cellular toxicity
- Direct incorporation of modified amino acids
- Lower yields for membrane proteins
- Higher cost
- May require optimization
Rapid screening, incorporation of unnatural amino acids, mechanistic studies

For functional studies and accurate pharmacological characterization, mammalian expression systems are generally preferred as they provide the most physiologically relevant environment for TACR2.

What are critical considerations for designing recombinant rabbit TACR2 constructs?

When designing constructs for recombinant rabbit TACR2 expression, researchers should address several factors to optimize expression and functionality:

  • Codon optimization: Adapt the nucleotide sequence to the preferred codon usage of the expression host while avoiding rare codons that might reduce translation efficiency.

  • Signal peptide selection: The native signal peptide may be replaced with well-characterized alternatives (e.g., hemagglutinin signal peptide) to enhance membrane targeting in heterologous systems.

  • Affinity tags and fusion partners:

    • N-terminal tags may interfere with signal peptide cleavage

    • C-terminal tags are generally preferred for GPCRs but may affect G protein coupling

    • Common tags include His6, FLAG, and HA

    • Fusion partners like BRIL, T4 lysozyme, or GFP can enhance expression or stability

  • Potential modifications to enhance expression:

    • Removal of predicted proteolytic sites

    • Introduction of thermostabilizing mutations based on alanine scanning

    • Deletion or modification of flexible regions that may cause aggregation

    • Codon optimization for the expression host

  • Expression vector selection: Consider promoter strength, selection markers, and regulatory elements appropriate for the chosen expression system.

How can recombinant rabbit TACR2 be used in binding assays to characterize novel ligands?

Recombinant rabbit TACR2 provides a controlled system for characterizing the binding properties of novel ligands through various experimental approaches:

Assay TypePrincipleAdvantagesTechnical Considerations
Radioligand bindingCompetition between labeled reference ligand and test compound- Gold standard for affinity determination
- High sensitivity and reproducibility
- Requires radioactive materials
- Higher-affinity radioligands preferred
- Non-specific binding must be determined
- Separation of bound/free ligand needed
Fluorescence-based bindingDisplacement of fluorescent ligand or direct binding of fluorescent compound- No radioactivity
- Amenable to high-throughput screening
- Real-time measurements possible
- Potential interference from intrinsic fluorescence
- Background fluorescence
- Fluorophore may alter binding properties
Surface Plasmon ResonanceDetection of mass changes at sensor surface when ligand binds immobilized receptor- Label-free detection
- Real-time kinetics (kon and koff)
- Small sample requirements
- Requires purified receptor protein
- Surface immobilization may affect conformation
- Regeneration conditions needed for reuse
Time-Resolved FRETEnergy transfer between donor on receptor and acceptor on ligand- High signal-to-noise ratio
- Miniaturizable
- Homogeneous format (no separation)
- Requires fluorescent labeling
- Potential steric hindrance
- Distance dependency affects signal
Microscale ThermophoresisChanges in molecular movement in temperature gradients upon binding- Low sample consumption
- Works in complex matrices
- Minimal modification of receptor
- Temperature sensitivity
- Some compounds may autofluoresce
- Requires specialized equipment

When designing binding experiments with rabbit TACR2, researchers should consider:

  • Receptor expression level and homogeneity

  • Membrane preparation quality or cell viability

  • Buffer composition (pH, ionic strength, reducing agents)

  • Incubation temperature and equilibration time

  • Controls for non-specific binding

  • Data analysis using appropriate mathematical models

What functional assays are appropriate for characterizing signal transduction through recombinant rabbit TACR2?

Since TACR2 primarily couples to G proteins that activate phosphatidylinositol-calcium signaling pathways , several functional assays can be employed to measure receptor activation:

Functional AssaySignaling Pathway MeasuredAdvantagesLimitations
Intracellular calcium mobilizationGq/11 → PLC → IP3 → Ca2+ release- Rapid response (seconds)
- Real-time kinetics
- Automation-friendly
- High-throughput capability
- Transient signal
- Potential calcium toxicity
- Signal amplitude dependent on receptor expression
- Can be affected by calcium channel modulators
Inositol phosphate accumulationGq/11 → PLC → IP3/DAG production- Cumulative signal measurement
- Directly measures second messenger
- Not affected by calcium modulators
- Requires radioactive labeling (3H-inositol)
- Endpoint assay
- More labor-intensive
- Longer assay time
MAPK phosphorylationMultiple pathways including G protein and β-arrestin-mediated signaling- Measures downstream functional effects
- Can detect biased signaling
- Works with endogenous expression levels
- Pathway affected by multiple inputs
- Temporal dynamics critical
- Western blot quantification challenging
- High variability between cell types
GTPγS bindingDirect G protein activation- Proximal measure of receptor function
- Cell-free assay possible with membranes
- Directly measures G protein coupling
- Requires radioactive materials
- Lower throughput
- Technical expertise required
- Less sensitive than downstream assays
β-arrestin recruitmentReceptor desensitization pathway- Reveals biased signaling
- BRET/FRET-based assays are quantitative
- Good dynamic range
- May require fusion constructs
- Temporal aspects critical
- May not reflect physiological recruitment
Receptor internalizationDownregulation response- Physiologically relevant
- Can be monitored by imaging or ELISA
- Slower response (minutes to hours)
- Multiple pathways involved
- Technical variability

For comprehensive characterization, combining multiple assays targeting different aspects of signal transduction provides the most complete understanding of receptor pharmacology.

How should researchers approach structure-function studies of rabbit TACR2?

Structure-function studies of rabbit TACR2 require systematic modification of the receptor and evaluation of the functional consequences. Effective approaches include:

  • Sequence-based targeting:

    • Align rabbit TACR2 with other species and tachykinin receptor subtypes

    • Identify conserved motifs and divergent regions

    • Target highly conserved residues for mutagenesis to identify critical functional elements

    • Focus on divergent residues to understand subtype or species specificity

  • Structure-guided approaches:

    • Generate homology models based on related GPCR crystal structures

    • Identify residues in predicted binding pockets

    • Target residues in G protein interaction interfaces

    • Focus on regions involved in conformational changes during activation

  • Systematic mutagenesis strategies:

    • Alanine scanning of transmembrane domains

    • Conservative substitutions to probe specific chemical interactions

    • Chimeric receptors swapping domains between related receptors

    • Domain deletion or insertion to test structural elements

  • Experimental validation combining:

    • Ligand binding assays to assess affinity changes

    • Functional assays to assess signaling alterations

    • Surface expression measurements to confirm proper folding and trafficking

    • Conformational studies using intramolecular sensors or accessibility measurements

How can rabbit TACR2 be used to investigate species differences in tachykinin pharmacology?

Species differences in TACR2 pharmacology provide valuable insights for translational research. Rabbit TACR2 serves as an important comparative model due to its distinct pharmacological profile:

  • Comparative sequence analysis:

    • Alignment of rabbit TACR2 with human, mouse, and other species reveals key differences

    • Identification of species-specific amino acids in binding domains

    • Evolutionary conservation analysis highlights functionally important residues

    SpeciesSequence Identity with Rabbit TACR2Key Divergent RegionsPharmacological Implications
    Human~85%ECL2, TM5Differences in antagonist binding
    Mouse~82%N-terminus, ECL3Altered selectivity for certain peptides
    Rat~83%ICL3, C-terminusDifferences in signaling efficiency
    Guinea Pig~87%ECL2, TM7Closest pharmacological profile to rabbit
  • Comparative pharmacology approaches:

    • Parallel testing of ligand panels across species orthologs

    • Identification of species-selective compounds

    • Characterization of differences in signaling bias between species

  • Chimeric receptor studies:

    • Swapping domains between rabbit and human TACR2

    • Identifying regions responsible for species-specific pharmacology

    • Creating humanized rabbit receptors for translational research

  • Application to drug discovery:

    • Prediction of human responses based on multi-species profiling

    • Understanding evolutionary conservation of binding sites

    • Identification of species-conserved effects more likely to translate to humans

What approaches are available for studying TACR2 dimerization or oligomerization?

GPCR dimerization can significantly impact receptor pharmacology and function. For rabbit TACR2, several complementary approaches can assess potential oligomerization:

  • Biophysical techniques:

    • Resonance energy transfer methods (BRET/FRET)

    • Single-molecule imaging and tracking

    • Fluorescence recovery after photobleaching (FRAP)

    • Time-resolved FRET with labeled antibodies against epitope tags

  • Biochemical approaches:

    • Chemical cross-linking followed by immunoprecipitation

    • Blue native PAGE to preserve protein complexes

    • Proximity ligation assays in native tissues

    • Co-immunoprecipitation with differentially tagged receptors

  • Functional validation:

    • Dominant-negative constructs to disrupt function

    • Trans-complementation between binding-deficient and signaling-deficient mutants

    • Bivalent ligands targeting dimeric receptors

    • Allosteric modulation through dimer interfaces

  • Computational prediction:

    • Molecular dynamics simulations of receptor interactions

    • Analysis of potential dimerization interfaces

    • Energy calculations for stability of dimer formations

When designing these experiments, researchers should consider several critical factors:

  • Expression levels that avoid artificial aggregation

  • Controls for non-specific interactions

  • Methods to distinguish between dimerization and clustering

  • Validation in multiple systems including native tissues

How can recombinant systems help resolve contradictory findings in TACR2 signaling?

Contradictory findings in TACR2 signaling research can arise from multiple factors. Recombinant systems offer controlled environments to systematically investigate discrepancies:

  • Expression level standardization:

    • Titrated expression using inducible promoters

    • Quantification of receptor density by radioligand binding

    • Single-cell analysis to account for heterogeneous expression

    • Comparison with physiological expression levels

  • Defined cellular backgrounds:

    • Use of cells lacking endogenous tachykinin receptors

    • Knockout of specific signaling components to determine requirements

    • Reconstitution of signaling pathways in simplified systems

    • Comparison across multiple cell backgrounds

  • Temporal resolution of signaling:

    • Real-time measurements of multiple signaling outputs

    • Comparison of acute vs. sustained responses

    • Investigation of desensitization and internalization kinetics

    • Analysis of signaling adaptation over different time scales

  • Systematic protocol comparison:

    • Standardization of buffer conditions, temperature, and other variables

    • Side-by-side comparison of different assay methodologies

    • Round-robin testing across different laboratories

    • Development of standard operating procedures

When addressing contradictions, researchers should develop experimental designs that specifically test competing hypotheses while controlling for variables that might explain discrepancies in previous studies.

What quality control measures are essential when working with recombinant rabbit TACR2?

Rigorous quality control is critical for ensuring reliable results with recombinant TACR2:

  • Molecular validation:

    • Sequence verification of expression constructs

    • Restriction enzyme digestion patterns

    • Stability of the construct during cell propagation

    • Absence of unwanted mutations or recombination events

  • Expression validation:

    • Western blotting to confirm expression at expected molecular weight

    • Flow cytometry to assess surface expression levels

    • Immunofluorescence microscopy to verify cellular localization

    • Quantitative PCR to measure transcript levels

  • Functional validation:

    • Binding of reference ligands with expected affinity

    • Dose-response curves with appropriate EC50/IC50 values

    • Expected signaling in response to known agonists

    • Appropriate antagonist blockade

    • Comparison with published parameters for rabbit TACR2

  • Stability assessment:

    • Consistent expression over passage number

    • Reproducible functional responses over time

    • Storage stability of membrane preparations

    • Freeze-thaw stability for preserved samples

  • System-specific validations:

    • For purified receptor: homogeneity by size exclusion chromatography

    • For stable cell lines: clonality and expression uniformity

    • For transient transfections: transfection efficiency and expression window

How should researchers address potential artifacts in rabbit TACR2 studies?

Several artifacts can confound studies with recombinant TACR2. Researchers should implement specific controls and considerations:

  • Expression-related artifacts:

    • Compare multiple expression levels to identify overexpression effects

    • Use inducible systems to compare different expression conditions

    • Include wild-type (untransfected) cells as negative controls

    • Compare with native tissues expressing TACR2 when possible

  • Tag and fusion protein concerns:

    • Compare tagged and untagged versions to assess tag interference

    • Place tags at different positions to determine optimal placement

    • Use multiple tag types to confirm findings aren't tag-specific

    • Control for potential dimerization induced by fluorescent protein tags

  • Cell background influences:

    • Test multiple cell backgrounds to identify cell-specific effects

    • Characterize endogenous signaling components in chosen cell lines

    • Consider knockout or knockdown of potential interfering proteins

    • Document the complete cellular context of experiments

  • Technical artifacts:

    • Include appropriate vehicle controls for all reagents

    • Control for ligand stability under experimental conditions

    • Verify compound solubility and avoid precipitation

    • Test for direct effects of compounds on assay readouts

    • Include positive controls for assay functionality

  • Validation approaches:

    • Confirm key findings with orthogonal assay methodologies

    • Perform concentration-response curves rather than single concentrations

    • Include time-course analyses for signaling responses

    • Use multiple reference compounds to calibrate the system

What approaches can resolve conflicting pharmacological data for rabbit TACR2?

When faced with conflicting pharmacological data regarding rabbit TACR2, researchers should:

  • Implement systematic pharmacological analysis:

    • Full concentration-response curves rather than single-point measurements

    • Determination of both potency (EC50/IC50) and efficacy parameters

    • Use of multiple reference compounds for system calibration

    • Application of the operational model of agonism to determine coupling efficiency

    • Analysis of competitive vs. non-competitive antagonism

  • Consider signaling bias:

    • Parallel measurement of multiple signaling pathways

    • Calculation of bias factors using appropriate reference ligands

    • Time-course analysis to capture temporal aspects of signaling

    • Integration of immediate and downstream responses

  • Account for experimental variables:

    • Buffer composition effects (particularly calcium and magnesium concentrations)

    • Temperature sensitivity of binding and signaling

    • Receptor reserve effects in different expression systems

    • Ligand solubility and stability in assay conditions

  • Statistical rigor:

    • Appropriate sample size based on power calculations

    • Blinded experimental design where possible

    • Technical and biological replicates

    • Robust statistical methods appropriate for the data structure

  • Transparent reporting:

    • Complete methodology description for reproducibility

    • Sharing of raw data when possible

    • Acknowledgment of limitations and potential confounds

    • Consideration of alternative interpretations of the data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.