Recombinant Rabbit Synaptophysin-like protein 2 (SYPL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SYPL2; MG29; Synaptophysin-like protein 2; Mitsugumin-29; Mg29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
Full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
SYPL2
Target Protein Sequence
MSSTESPSRAADKSPRQQVDRLLEGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GAMVRCNNEAKDVSSIIVLFGYPFRLHRIEYEMPLCDDDSSSKTMHLMGDFSAPAEFFVT LGIFSFFYTMAALVVYLRFHKLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWH GQGQDQGQGPSQESAAEQGAVEKQ
Uniprot No.

Target Background

Function
Synaptophysin-like protein 2 (SYPL2) plays a crucial role in communication between the T-tubular and junctional sarcoplasmic reticulum (SR) membranes.
Gene References Into Functions
  1. Calcium (Ca2+) transients in skeletal muscle are regulated through the interaction between Mg29 and TRPC3. PMID: 26141232
Database Links
Protein Families
Synaptophysin/synaptobrevin family
Subcellular Location
Membrane; Multi-pass membrane protein. Note=Triad junction, the junctional complex between the transverse tubule and the sarcoplasmic reticulum.
Tissue Specificity
Skeletal muscle.

Q&A

What is Synaptophysin-like Protein 2 and how does it relate to the Synaptophysin family?

Synaptophysin-like Protein 2 (SYPL2) belongs to the synaptophysin protein family, which includes the well-characterized synaptophysin - an N-glycosylated integral membrane protein found in neurons and endocrine cells. While synaptophysin contains four transmembrane domains and functions as a gap junction-like channel in neurosecretory vesicles, SYPL2 has a more tissue-specific expression pattern. Both proteins are involved in neuroendocrine signaling, but SYPL2 shows enrichment primarily in skeletal muscles and the tongue rather than having the broad neural distribution of synaptophysin .

Unlike synaptophysin, which is widely used as an independent, broad-range marker of neural and neuroendocrine differentiation, SYPL2's specialized tissue distribution suggests distinct physiological functions that require further characterization. Researchers should note that while these proteins share structural similarities, their differential expression patterns suggest divergent functional roles in tissue-specific contexts .

What expression patterns characterize SYPL2 in normal tissues versus pathological conditions?

Analysis across multiple public databases confirms that SYPL2 expression levels are significantly higher in CRC tissues compared to normal colorectal tissues (P < 0.05). This dysregulation appears to have clinical significance, as elevated SYPL2 expression correlates with more aggressive disease features, including lymph node metastasis. The dramatic shift in expression pattern from normal to pathological states suggests SYPL2 may play a role in cancer progression mechanisms rather than simply representing an ancestral marker of cell type .

What approaches are recommended for selecting and validating antibodies for SYPL2 detection?

For reliable SYPL2 detection, researchers should implement a comprehensive antibody validation strategy similar to that used for other synaptophysin family members. The recommended approach involves comparing readouts between wild-type (WT) and knockout (KO) cell lines to ensure antibody specificity. This critical validation step prevents misinterpretation caused by non-specific binding or cross-reactivity with related proteins .

The validation process should include:

  • Cell line selection using transcriptomics databases (e.g., DepMap) to identify lines with sufficient SYPL2 expression (typically >2.5 log2 TPM+1)

  • Generation of SYPL2 knockout cell lines using CRISPR/Cas9 technology

  • Parallel testing of multiple commercially available antibodies against both WT and KO lysates

  • Validation across multiple experimental techniques (western blot, immunoprecipitation, immunofluorescence, flow cytometry)

This systematic approach ensures confidence in experimental outcomes and prevents misleading results due to antibody quality issues .

How can researchers effectively generate and validate SYPL2 knockout models?

To generate reliable SYPL2 knockout models, researchers should first identify appropriate cell lines with significant endogenous SYPL2 expression. Based on the DepMap transcriptomics database approach described for similar proteins, cell lines expressing SYPL2 at levels greater than 2.5 log2 (TPM+1) should be selected as candidates for modification .

The CRISPR/Cas9 system represents the gold standard for generating knockout models, allowing precise targeting of the SYPL2 gene. The validation process should include:

Validation MethodPurposeExpected Outcome
Genomic PCRConfirm editing at DNA levelAltered amplicon size compared to WT
Western blotConfirm protein eliminationAbsence of SYPL2 band in KO lysates
RT-qPCRAssess transcript levelsSignificant reduction in SYPL2 mRNA
Phenotypic assaysAssess functional consequencesAlterations in relevant cellular processes

This comprehensive validation ensures the knockout model accurately represents SYPL2 deficiency for downstream experimental applications .

What evidence supports SYPL2's role in colorectal cancer progression?

Substantial evidence indicates SYPL2 plays a significant role in colorectal cancer progression. Analysis of multiple public databases and clinical samples demonstrates significantly elevated SYPL2 expression in CRC tissues compared to normal colorectal tissues. This overexpression correlates with increased lymph node metastasis (LNM) and poorer patient outcomes .

What molecular pathways are associated with SYPL2 in cancer development?

Gene Set Enrichment Analysis (GSEA) has revealed that SYPL2 expression in colorectal cancer associates with several critical cancer-related pathways. Specifically, SYPL2 upregulation correlates with enrichment of pathways involved in:

  • Regulation of epithelial cell migration

  • Vasculature development

  • Various cancer signaling pathways

Additionally, SYPL2 expression shows strong positive correlation with KDR (P < 0.0001, r = 0.47), a key receptor in angiogenesis, and significantly associates with BRAF V600E mutations (P < 0.05). These connections suggest SYPL2 may participate in complex molecular networks that drive cancer progression through effects on cell migration, angiogenesis, and growth signaling pathways .

The association with the tumor microenvironment is particularly noteworthy, as higher SYPL2 expression correlates with enrichment of CD8 T-cells and M0 macrophages, suggesting potential immunomodulatory functions that could influence cancer progression through alteration of the tumor immune landscape .

How can researchers approach eQTL analysis for SYPL2?

For effective expression quantitative trait locus (eQTL) analysis of SYPL2, researchers should implement a systematic approach that accounts for potential multiple independent signals. Research indicates that SYPL2 demonstrates complex eQTL patterns, with evidence of both primary and secondary eQTL signals that may differentially associate with phenotypes such as lipid traits .

The recommended methodology includes:

This approach has revealed that while primary SYPL2 eQTL signals may not colocalize with lipid traits (LDL/TC), secondary SYPL2 eQTL signals show evidence of colocalization, suggesting complex genetic architecture underlying SYPL2 regulation and its relationship to phenotypes .

What quality control measures are critical when analyzing SYPL2 genetic data?

When analyzing genetic data related to SYPL2, researchers must implement rigorous quality control procedures to prevent false-positive findings. Data heterogeneity between genome-wide association studies (GWAS) and linkage disequilibrium (LD) reference panels can significantly impact results, particularly for conditional analyses that may identify secondary signals .

The DENTIST methodology represents an important quality control approach that:

Implementing these quality control measures can reduce false-positive rates in conditional analysis from >28% to <2% in the presence of heterogeneity between GWAS and LD reference panels. This is particularly important for SYPL2 analysis, where secondary eQTL signals may have biological and clinical relevance .

How does SYPL2 interact with the tumor microenvironment?

Recent analyses using the CIBERSORT algorithm have revealed significant associations between SYPL2 expression and specific immune cell populations in the tumor microenvironment. Higher SYPL2 expression correlates with enrichment of CD8 T-cells and M0 macrophages, suggesting potential immunomodulatory functions .

These findings open several investigative avenues:

  • Determining whether SYPL2 directly influences immune cell recruitment or activation

  • Exploring if SYPL2-expressing cancer cells evade immune surveillance through specific mechanisms

  • Investigating potential applications for immunotherapy response prediction based on SYPL2 expression

  • Examining whether targeting SYPL2 might enhance anti-tumor immune responses

Understanding these interactions could provide insights into how SYPL2 contributes to cancer progression and potential therapeutic vulnerabilities in SYPL2-expressing tumors .

What integrative approaches can reveal SYPL2's role in complex disease networks?

To fully elucidate SYPL2's role in complex disease networks, researchers should implement integrative multi-omics approaches. The combination of transcriptomics, proteomics, and genetic association data can provide comprehensive insights into SYPL2's functional relevance .

Recommended integrative strategies include:

These integrative approaches can help establish whether SYPL2 is merely a biomarker or plays a causal role in disease processes, potentially identifying new therapeutic opportunities .

What are common challenges in distinguishing SYPL2 from other synaptophysin family members?

Distinguishing SYPL2 from other synaptophysin family proteins presents significant technical challenges due to structural similarities. Researchers must implement rigorous controls to ensure specificity in their detection methods. Common issues include antibody cross-reactivity, which can lead to false-positive signals and misinterpretation of results .

To address these challenges, researchers should:

  • Use multiple antibodies targeting different epitopes of SYPL2

  • Include synaptophysin knockout/knockdown controls to assess cross-reactivity

  • Perform tissue-specific validation, given SYPL2's enrichment in skeletal muscle and tongue

  • Validate findings using orthogonal methods (e.g., mass spectrometry, RNA-seq)

Careful attention to these methodological details ensures reliable differentiation between SYPL2 and related proteins, preventing misattribution of biological functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.