Recombinant Rabbit T-lymphocyte activation antigen CD80 (CD80)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

CD80 is a transmembrane glycoprotein in the immunoglobulin superfamily. Its recombinant form retains the ability to interact with receptors CD28 and CTLA-4 on T cells, modulating immune responses through:

  • T-cell Activation: Binds CD28 to amplify MHC/TCR signals, activating NF-κB and MAPK pathways, which drive cytokine production and T-cell proliferation .

  • Metabolic Regulation: Enhances glucose metabolism and ATP synthesis in T cells via PI3K/Akt signaling .

  • Immune Checkpoint Modulation: Competes with PD-1 for PDL1 binding, reducing immunosuppression in tumor microenvironments .

Therapeutic Development

  • Cancer Immunotherapy: Soluble CD80-Fc fusion proteins delay tumor growth in murine models (e.g., CT26 colon carcinoma, B16F10 melanoma) by dual targeting:

    • Blocks PD-1/PDL1 interactions .

    • Activates CD28-mediated T-cell responses .

    • In vivo studies show prolonged survival (100% survival in CD80-Fc-treated mice vs. 50% in controls) .

Vaccine Adjuvants

  • Recombinant CD80-expressing herpes simplex virus (HSV-CD80) enhances dendritic cell (DC) infection and T-cell activation, reducing T-cell exhaustion in preclinical models .

Key Research Findings

StudyModelOutcomeReference
CD80-Fc monotherapyCT26 tumors100% survival at day 42 vs. 50% in untreated controls
HSV-CD80 infection of DCsMouse DCsIncreased TIL (tumor-infiltrating lymphocytes) and reduced T-cell exhaustion
PD1/CTLA-4 dual targetingHuman PBMCsEnhanced T-cell activation without CTLA-4-mediated suppression

Production and Quality Control

  • Vector Design: Codon-optimized for rabbit CD80, fused with His tag for immobilized metal affinity chromatography (IMAC) .

  • Validation:

    • Purity confirmed by SDS-PAGE and Western blot .

    • Functional assays include T-cell proliferation and cytokine secretion .

Potential Therapeutic Implications

  • Combination Therapies: Synergizes with anti-PDL1 antibodies to improve checkpoint blockade efficacy .

  • Autoimmune Disease Research: Modulates germinal center B-T cell interactions, relevant in lupus and rheumatoid arthritis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CD80; T-lymphocyte activation antigen CD80; Activation B7-1 antigen; CD antigen CD80
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-299
Protein Length
Full Length of Mature Protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
Target Protein Sequence
GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG
Uniprot No.

Target Background

Function
CD80, also known as B7-1, is involved in the costimulatory signal essential for T lymphocyte activation. Binding of CD28 or CTLA-4 to this receptor induces T-cell proliferation and cytokine production.
Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is CD80 and what are its primary functions in the immune system?

CD80 (also known as B7-1) is a costimulatory molecule belonging to the immunoglobulin superfamily that plays a crucial role in T-lymphocyte activation. It functions as the primary auxiliary signal that augments the MHC/TCR (Major Histocompatibility Complex/T-cell Receptor) signal in naive T-cells by interacting with the CD28 receptor, which is constitutively expressed on T-cell surfaces . This interaction activates various signaling pathways such as NF-kappa-B and MAPK, leading to cytokine production . Additionally, the CD28/CD80 costimulatory signal stimulates glucose metabolism and ATP synthesis in T-cells through activation of the PI3K/Akt signaling pathway . CD80 also regulates PDL1/PDCD1 interactions, limiting excessive engagement of PDL1 and its inhibitory role in immune responses . When expressed on B-cells, CD80 critically regulates interactions between B-cells and T-cells in both early and late germinal center responses, which are essential for effective humoral immune responses .

How does recombinant rabbit CD80 differ from native CD80 protein?

Recombinant rabbit CD80 protein is artificially produced using expression systems like HEK 293 cells, whereas native CD80 is naturally expressed in immune cells. The recombinant version typically includes a His tag or other fusion tags to facilitate purification and detection in experimental settings . While maintaining the core functional domains (amino acids 33-241 in the recombinant fragment), the recombinant version offers several advantages over native CD80 for research purposes :

  • Higher purity (>95%) with controlled endotoxin levels (<1 EU/μg)

  • Consistent lot-to-lot quality due to standardized production methods

  • Specific fragment expression allowing focused study of particular domains

  • Animal-free manufacturing options for ethical research considerations

These differences make recombinant rabbit CD80 particularly valuable for controlled experimental settings where consistency and purity are essential parameters.

What are the structural characteristics of CD80 that enable its immunological functions?

CD80 contains distinct structural domains that facilitate its immunological functions:

DomainLocation (aa)Function
Extracellular33-241Contains binding sites for CD28 and CTLA-4
Transmembrane~242-265Anchors protein to cell membrane
Cytoplasmic~266-288Involved in signaling

The extracellular domain of CD80 contains immunoglobulin-like regions that form the binding interface with CD28 and CTLA-4 . The protein undergoes post-translational modifications, including glycosylation, which influences its molecular weight (appearing as 50-75 kDa in Western blots rather than its predicted size) . These structural elements collectively enable CD80 to function as a molecular bridge between antigen-presenting cells and T cells, facilitating the transmission of costimulatory signals necessary for T cell activation and regulation .

How do CD80 and CD86 differ in their regulatory roles during T cell activation?

While both CD80 (B7-1) and CD86 (B7-2) serve as ligands for CD28 and CTLA-4 (CD152), they exhibit distinct temporal expression patterns and functional roles in immune regulation. Studies indicate that CD86 plays a more prominent role in initial T cell activation, while CD80 is more involved in sustained responses and regulatory functions .

Key differences include:

  • Binding kinetics: CD80 binds to CTLA-4 with approximately 20-fold higher affinity than to CD28, while CD86 shows more balanced binding to both receptors .

  • Expression dynamics: CD86 is constitutively expressed at low levels and rapidly upregulated upon activation, whereas CD80 expression is predominantly induced after stimulation with slower kinetics but potentially longer duration .

  • Functional impact: Knockout mouse models have demonstrated that CD86 is more critical for T cell activation than CD80 . Conversely, CD80 appears more clearly involved in immune regulation through its preferential interaction with CTLA-4, mediating inhibitory signals that help maintain immune homeostasis .

  • Cell-type specificity: While both molecules are expressed on professional antigen-presenting cells, their relative expression levels vary across different cell types and activation states of dendritic cells, macrophages, and B cells .

These differences suggest tailored experimental approaches when targeting either molecule for immunomodulatory research or therapeutic development.

What experimental considerations are important when using recombinant CD80 for immune checkpoint research?

When conducting immune checkpoint research with recombinant CD80, several critical experimental considerations must be addressed:

  • Protein conformation: Ensure the recombinant CD80 maintains proper folding to accurately mimic native protein interactions. For rabbit recombinant CD80, expression in mammalian systems like HEK293 cells helps maintain appropriate post-translational modifications and protein folding .

  • Tag interference: Consider whether His-tags or other purification tags might interfere with binding interactions. Control experiments comparing tagged versus untagged versions may be necessary to validate findings .

  • Concentration optimization: CD80-CD28/CTLA-4 interactions are concentration-dependent, requiring careful titration in experimental systems. Too high concentrations may lead to non-physiological results, while too low concentrations may fail to elicit detectable responses .

  • Species cross-reactivity: When using rabbit recombinant CD80 in cross-species experiments, validate binding specificity and functionality, as sequence variations may affect interaction with human or mouse receptors .

  • Competitive binding considerations: Since CD80 binds both CD28 and CTLA-4 with different affinities, experimental designs should account for competitive binding dynamics when investigating checkpoint modulation .

  • Storage and stability: Recombinant proteins may lose activity over time or with temperature fluctuations. Follow manufacturer recommendations for storage (typically -80°C for long-term storage) and avoid repeated freeze-thaw cycles .

How can CD80 expression be effectively quantified in different experimental systems?

Quantification of CD80 expression requires selecting appropriate methods based on experimental context:

MethodApplicationsAdvantagesLimitations
Flow cytometryCell surface expressionSingle-cell resolution, multiparameterRequires live cells, surface-only detection
Western blottingTotal protein expressionDetects specific MW forms, semi-quantitativeCannot distinguish surface from intracellular
qRT-PCRTranscriptional regulationHigh sensitivity, specificmRNA may not correlate with protein levels
ELISASoluble/secreted CD80Quantitative, high-throughputLimited information on cellular origin
ImmunohistochemistryTissue expressionPreserves spatial contextSemi-quantitative, fixation artifacts

For optimal quantification in research settings:

  • Use recombinant CD80 standards of known concentration to generate standard curves for quantitative assays .

  • When performing Western blot analysis, recognize that CD80 typically appears between 50-75 kDa due to glycosylation rather than its predicted molecular weight .

  • For flow cytometry applications, calibration beads with known antibody binding capacity can convert mean fluorescence intensity into approximate molecules per cell.

  • Consider using multiple complementary methods to obtain a comprehensive view of CD80 expression and localization .

What are the optimal conditions for using recombinant rabbit CD80 in T cell activation assays?

For successful T cell activation assays using recombinant rabbit CD80:

  • Immobilization protocol: Coat plates with recombinant CD80 at 1-5 μg/mL in sterile PBS overnight at 4°C. For optimal results, combine with anti-CD3 antibodies (typically at 1 μg/mL) to provide both primary and costimulatory signals .

  • Cell preparation: Isolate T cells using negative selection to avoid pre-activation. Resuspend in complete media (RPMI 1640 with 10% FBS, L-glutamine, penicillin/streptomycin) at 1-2 × 10^6 cells/mL .

  • Incubation parameters: Culture cells at 37°C, 5% CO2 for 48-72 hours for optimal activation assessment. Consider testing multiple timepoints as CD80-mediated effects may vary temporally .

  • Readouts: Measure T cell proliferation (CFSE dilution, 3H-thymidine incorporation), cytokine production (ELISA, intracellular cytokine staining), and activation marker expression (CD25, CD69) to comprehensively assess activation status .

  • Controls: Include wells with anti-CD3 alone, recombinant CD80 alone, and medium-only conditions. For comparative studies, include CD86-coated wells and/or CTLA-4-Ig to block CD80-CD28 interactions .

Note that plate-bound recombinant CD80 typically provides stronger costimulation than soluble formats due to more effective receptor crosslinking .

How can researchers troubleshoot inconsistent results when using recombinant CD80 in experimental systems?

When encountering inconsistent results with recombinant CD80, consider the following troubleshooting approaches:

  • Protein quality assessment:

    • Verify protein integrity using SDS-PAGE before experiments

    • Check for degradation by comparing with previously functional lots

    • Confirm endotoxin levels are below threshold (<1 EU/μg) to prevent non-specific activation

  • Storage and handling issues:

    • Avoid repeated freeze-thaw cycles by aliquoting stock solutions

    • Use proper storage conditions (-80°C long-term, -20°C for working stocks)

    • Consider adding recommended preservatives like sodium azide (0.05-0.1%) for solutions stored at 4°C

  • Experimental design optimization:

    • Titrate recombinant CD80 concentration (typically 0.1-10 μg/mL range)

    • Test different immobilization methods (direct coating vs. capture antibody)

    • Optimize cell density and incubation times based on specific assay requirements

  • Cell responsiveness variables:

    • Check activation state of responding cells (naive vs. memory T cells respond differently)

    • Verify expression of CD28/CTLA-4 on target cells

    • Control for donor variability by using consistent cell sources

  • Specificity controls:

    • Include blocking antibodies against CD80 or CD28 to confirm observed effects are specific

    • Use isotype-matched control proteins with similar tags to distinguish specific from non-specific effects

What methodological approaches can be used to study CD80 interactions with its binding partners?

Several methodological approaches can effectively characterize CD80 interactions with binding partners like CD28 and CTLA-4:

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant CD80 on sensor chips

    • Measure real-time binding kinetics (ka, kd) and affinity (KD)

    • Compare binding parameters between different partners (CD28 vs. CTLA-4)

    • Typical affinities: CD80-CTLA-4 (KD ~0.2-0.4 μM), CD80-CD28 (KD ~4-8 μM)

  • Co-immunoprecipitation:

    • Use anti-CD80 antibodies to pull down protein complexes

    • Identify binding partners via Western blotting or mass spectrometry

    • Compare binding under different activation conditions

  • Fluorescence Resonance Energy Transfer (FRET):

    • Tag CD80 and potential partners with compatible fluorophores

    • Measure energy transfer as indicator of molecular proximity

    • Can be performed in live cells to assess dynamic interactions

  • Functional blocking studies:

    • Use domain-specific antibodies or mutant proteins

    • Identify critical binding regions through systematic blocking

    • Correlate binding inhibition with functional outcomes

  • Crystallography and structural biology:

    • Use purified recombinant proteins for structural determination

    • Map binding interfaces at atomic resolution

    • Guide design of interaction-specific modulators

These approaches provide complementary information about the specificity, affinity, and functional consequences of CD80 interactions.

How does CD80 expression change in different pathological conditions, and what are the implications for therapeutic targeting?

CD80 expression exhibits distinctive patterns across various pathological conditions:

Pathological ConditionCD80 Expression PatternPotential Therapeutic Implications
Autoimmune diseasesIncreased on APCs in affected tissuesBlocking CD80 may reduce pathological T cell activation
CancerOften downregulated to escape immune surveillanceAgonistic CD80 approaches may enhance anti-tumor immunity
Viral infectionsDynamic changes during disease progressionModulation may enhance viral clearance
Gallbladder squamous cell carcinomaDysfunction associated with pathogenesisPotential diagnostic/prognostic marker
MyocarditisAltered expression contributing to pathologyTarget for reducing inflammatory damage

The diverse CD80 expression patterns across these conditions highlight important research considerations:

  • Context-dependent effects: CD80 blockade may be beneficial in autoimmunity but potentially detrimental in cancer immunotherapy contexts .

  • Temporal dynamics: CD80 expression changes during disease progression necessitate time-course studies to determine optimal intervention points .

  • Cell type specificity: Different antigen-presenting cell populations (dendritic cells, B cells, macrophages) may exhibit varied CD80 regulation in disease states, requiring cell-specific targeting approaches .

  • Combination approaches: CD80-targeted interventions often work synergistically with other immune checkpoint modulators, suggesting the importance of studying combinatorial effects in experimental systems .

What are the key methodological considerations when comparing CD80 expression across different species models?

When comparing CD80 expression and function across species models:

  • Sequence homology awareness: While CD80 is functionally conserved, amino acid sequence identity varies between species (approximately 50-60% between human and mouse). Rabbit CD80 represents an intermediate model with distinct advantages for certain comparative studies .

  • Reagent cross-reactivity validation:

    • Antibodies: Thoroughly validate species cross-reactivity through positive and negative controls

    • Recombinant proteins: Test binding to receptors from different species

    • Primers/probes: Design species-specific reagents for accurate quantification

  • Expression pattern differences:

    • Document baseline expression in equivalent tissues across species

    • Note species-specific induction kinetics following activation

    • Consider differences in glycosylation patterns affecting molecular weight

  • Functional assay adaptation:

    • Adjust culture conditions for species-specific cell requirements

    • Use species-matched cytokine detection reagents

    • Account for differences in activation marker expression kinetics

  • Translation considerations:

    • Document differences in CD80-CD28/CTLA-4 binding affinities across species

    • Consider species-specific signaling pathway variations

    • Note potential differences in soluble versus membrane-bound forms

Researchers should maintain detailed records of these species-specific variations to facilitate accurate interpretation of comparative studies and appropriate extrapolation to human applications.

What emerging technologies are advancing the study of CD80 function in complex immune microenvironments?

Several cutting-edge technologies are transforming CD80 research in complex immune contexts:

  • Single-cell technologies:

    • Single-cell RNA sequencing allows correlation of CD80 expression with comprehensive transcriptional profiles at individual cell resolution

    • Mass cytometry (CyTOF) enables simultaneous quantification of CD80 alongside dozens of other proteins on single cells

    • These approaches reveal previously unrecognized heterogeneity in CD80 expression across cell subpopulations

  • Advanced imaging techniques:

    • Multiplex immunofluorescence imaging allows visualization of CD80 in spatial context with multiple markers

    • Intravital microscopy enables real-time observation of CD80-mediated interactions in living tissues

    • Super-resolution microscopy reveals nanoscale organization of CD80 within the immunological synapse

  • Engineered protein approaches:

    • Structure-guided engineering of CD80 variants with altered binding properties

    • Bifunctional fusion proteins combining CD80 domains with other immune modulators

    • These tools enable mechanistic dissection of complex immune interactions

  • CRISPR-based screening:

    • Genome-wide screens identifying regulators of CD80 expression

    • Precise genetic modification of CD80 binding domains

    • Creation of reporter systems for dynamic monitoring of CD80 activation

  • Systems biology integration:

    • Computational modeling of CD80-CD28/CTLA-4 interaction networks

    • Prediction of intervention points for targeted modulation

    • Integration of multi-omics data to contextualize CD80 function

These emerging approaches collectively enhance our ability to study CD80 in physiologically relevant settings and develop more precise immunomodulatory strategies.

How can researchers optimize experimental design when studying CD80's role in the germinal center reaction?

Studying CD80's role in germinal center (GC) reactions requires specialized experimental approaches:

  • Model selection considerations:

    • In vitro: Co-culture systems with B cells, T follicular helper cells, and follicular dendritic cells

    • Ex vivo: Isolated lymphoid follicles maintaining 3D architecture

    • In vivo: Animal models with trackable antigen-specific B and T cells

  • Temporal dynamics assessment:

    • Early GC initiation (days 1-4 post-immunization)

    • Established GC reactions (days 7-14)

    • Late-phase GC resolution (days 21+)

    • CD80 functions differently across these phases, necessitating time-course analyses

  • Compartment-specific analysis:

    • Dark zone versus light zone distinction

    • Differential CD80 requirements in each zone

    • T-B border interactions preceding GC formation

    • Use zone-specific markers (CXCR4, CD83) for accurate localization

  • Functional readouts:

    • B cell fate decisions (memory vs. plasma cell differentiation)

    • Somatic hypermutation frequency and patterns

    • Affinity maturation progression

    • Class-switch recombination efficiency

  • Intervention strategies:

    • Conditional genetic deletion (CD80^flox/flox^ with cell-specific Cre)

    • Temporal control using inducible systems

    • Compartment-specific targeting using zone-restricted expression

    • Combined CD80/CD86 manipulation to control for compensatory mechanisms

These specialized approaches help isolate CD80's multiple roles throughout the complex and dynamic germinal center reaction, which is crucial for understanding humoral immunity development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.