Recombinant Rabbit Type I iodothyronine deiodinase (DIO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DIO1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Oryctolagus cuniculus (Rabbit)
Target Names
DIO1
Target Protein Sequence
MGLPRPGLWLKRLWVLVQVAVEVAVGKVLMTLFPERVKQNILAMGQKTGIAQNPNFAQDS WIPTFFSTQYFWFVLKVRWQRLEDATEPGGLAPNCSVVRLSGQQCSVWDFMRGNRPLVLN FGSCTUPSFLSKFDQFKRLIQDFSSIADFLIIYIEEAHASDGWAFKNNVDIKNHRNLQDR LRAASLLLARSPQCPVVVDTMQNQSSQLYAALPERLYVLRQGRILYKGESGPWNYNPEEV RAVLEELHS
Uniprot No.

Target Background

Function

Recombinant Rabbit Type I iodothyronine deiodinase (DIO1) catalyzes the deiodination of thyroxine (T4) to triiodothyronine (T3) and the deiodination of T3 to 3,3'-diiodothyronine (T2).

Database Links
Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Type I iodothyronine deiodinase (DIO1) and what distinguishes it from other deiodinase enzymes?

DIO1 is a selenocysteine-containing enzyme that catalyzes both outer ring deiodination (ORD) and inner ring deiodination (IRD) of thyroid hormones. Unlike the other two deiodinase enzymes (DIO2 and DIO3), DIO1 is non-selective in its deiodination activity. DIO2 exclusively catalyzes ORD, while DIO3 only performs IRD. DIO1 is further distinguished by its sensitivity to inhibition by 6-n-propyl-2-thiouracil (PTU), its relatively high Km for preferred substrates (T3 and reverse T3), and its ping-pong reaction kinetics .

These characteristics make DIO1 unique among deiodinases and particularly important for researchers studying thyroid hormone metabolism. The dual functionality of DIO1 enables it to both activate T4 to T3 through ORD and inactivate T4 and T3 through IRD, positioning it as a critical regulator of thyroid hormone homeostasis.

How does the catalytic efficiency of DIO1 vary across different substrates?

DIO1 exhibits remarkable substrate-dependent catalytic efficiency. Its efficiency for ORD of reverse T3 (rT3) is more than 100-fold higher than for ORD of T4. Additionally, the sulfoconjugation of T4 and T3 significantly enhances the efficiency of inner ring deiodination catalyzed by DIO1 . This substrate preference profile has important implications for experimental design when working with recombinant rabbit DIO1.

SubstrateRelative Catalytic EfficiencyKey Characteristics
rT3 (ORD)+++++Highest efficiency substrate
T4 (ORD)+>100× lower than rT3
T3 (IRD)++Modest efficiency
Sulfated T4++++Greatly enhanced IRD
Sulfated T3++++Greatly enhanced IRD

Note: Relative efficiency indicated by + symbols (more + means higher efficiency)

What are the primary tissues expressing DIO1 in rabbits, and how does this compare with other species?

DIO1 is primarily expressed in the liver, kidney, and thyroid gland across most species including rabbits . This tissue distribution pattern is relatively conserved across mammals, although expression levels can vary significantly. In rabbits specifically, DIO1 activity in the liver plays a critical role in peripheral conversion of T4 to T3.

During critical illness in rabbits, hepatic DIO1 activity decreases significantly, correlating with lower plasma and tissue T3 levels . This finding has important implications for researchers using rabbit models to study thyroid hormone metabolism in pathological conditions.

What is the significance of the selenocysteine residue in DIO1's catalytic center?

The selenocysteine (Sec) residue in DIO1's catalytic center is essential for its enzymatic activity. DIO1 was the first iodothyronine deiodinase identified as a selenoprotein, with the selenocysteine residue directly participating in the catalytic mechanism . This selenocysteine is encoded by a UGA codon, which typically serves as a stop codon but is recoded to incorporate selenocysteine in the presence of a selenocysteine insertion sequence (SECIS) element in the mRNA.

For researchers working with recombinant rabbit DIO1, the selenocysteine residue presents unique challenges in expression systems. Standard prokaryotic or eukaryotic expression systems may not efficiently incorporate selenocysteine, potentially resulting in truncated or catalytically inactive proteins. Specialized expression systems that can efficiently recognize the SECIS element and incorporate selenocysteine are crucial for producing functional recombinant DIO1.

How do temperature conditions affect DIO1 activity in rabbit compared to other species?

Temperature optimum for DIO1 activity varies significantly across species. While mammalian and avian DIO1 typically shows optimal activity around 37°C, fish DIO1 exhibits temperature optima that correlate with their environmental temperature ranges . For rabbit DIO1, the optimal temperature for enzymatic activity is approximately 37°C, similar to other mammals.

This temperature dependence has important methodological implications for in vitro assays of recombinant rabbit DIO1. Researchers should maintain reaction temperatures at 37°C to accurately assess enzymatic activity and ensure comparability with studies using human or rat DIO1. Deviations from this temperature can significantly affect catalytic rates and substrate preferences.

Which amino acid residues are critical for DIO1's substrate specificity and catalytic activity?

Specific amino acid residues play crucial roles in determining DIO1's substrate specificity and catalytic activity. Comparative analysis across species has identified phenylalanine at position 65 (corresponding to human DIO1 numbering) as particularly important for outer ring deiodination of reverse T3 . This aromatic residue is thought to interact with the mono-substituted inner ring of rT3.

In species like dog and cat that have different amino acids at this position, the efficiency of rT3 deiodination is significantly reduced. Additional structural elements that influence DIO1 activity include a region between amino acid residues 40-70, with positions 48-52 also contributing to substrate specificity .

For researchers working with recombinant rabbit DIO1, these structure-function relationships highlight critical regions that should be preserved during cloning and expression to maintain native enzymatic properties.

What are the optimal expression systems for producing functional recombinant rabbit DIO1?

Producing functional recombinant rabbit DIO1 requires careful consideration of expression systems due to the selenocysteine residue in its active site. Based on successful approaches with other deiodinases, mammalian expression systems (such as HEK293 or COS-7 cells) transfected with vectors containing appropriate SECIS elements offer the most reliable method for obtaining catalytically active recombinant DIO1.

The expression vector should include:

  • The full rabbit DIO1 coding sequence

  • A functional SECIS element in the correct orientation

  • Optional affinity tags (preferably at the C-terminus to avoid interfering with the N-terminal region important for activity)

  • Supplementation of culture media with selenium to ensure adequate selenocysteine incorporation

Baculovirus expression systems have also been successfully employed for deiodinase production, offering potential advantages in protein yield while maintaining proper folding and selenocysteine incorporation.

What assays are recommended for measuring DIO1 enzymatic activity in recombinant preparations?

Several assay methods can be employed to measure the enzymatic activity of recombinant rabbit DIO1:

  • Radioisotope-based assays: Using 125I-labeled substrates (typically 125I-rT3 or 125I-T4) and measuring the release of 125I- ions. This remains the gold standard for sensitivity and specificity.

  • HPLC-based methods: Quantifying reaction products (T3, T2, or iodide) after separation by high-performance liquid chromatography.

  • Colorimetric assays: Based on the detection of released iodide, though these have lower sensitivity than radioisotope methods.

Critical assay considerations include:

  • Maintaining a reducing environment (typically with dithiothreitol) at 5-20 mM concentration

  • pH optimization (typically pH 7.0-7.4)

  • Temperature control at 37°C

  • Inclusion of appropriate controls (heat-inactivated enzyme, PTU inhibition)

The choice of substrate is also important, with reverse T3 typically providing the most sensitive assessment of DIO1 activity due to its higher catalytic efficiency .

How can researchers verify the structural integrity of recombinant rabbit DIO1?

Verifying the structural integrity of recombinant rabbit DIO1 involves multiple complementary approaches:

  • Western blotting: Using specific anti-DIO1 antibodies. Both polyclonal and monoclonal antibodies against DIO1 are commercially available, though species cross-reactivity should be verified .

  • Mass spectrometry: To confirm the correct molecular weight and sequence, with special attention to selenocysteine incorporation.

  • Circular dichroism spectroscopy: To assess secondary structure elements.

  • Limited proteolysis followed by mass spectrometry: To evaluate proper folding.

  • Enzymatic activity assays: As the ultimate functional verification of proper structure.

For immunodetection methods, researchers should note that appropriate working dilutions for anti-DIO1 antibodies typically range from 1:250-2500 for Western blotting and 1:25-100 for immunohistochemistry and immunocytochemistry .

How does rabbit DIO1 compare to human and rat DIO1 in terms of sequence homology and enzymatic properties?

Rabbit DIO1 shares significant sequence homology with both human and rat DIO1, though comprehensive comparison data specifically for rabbit is limited in the literature. Based on available data for other mammals, we can estimate that rabbit DIO1 likely shares approximately 70-80% amino acid sequence identity with human DIO1, with highly conserved regions around the catalytic site and selenocysteine residue.

The enzymatic properties of rabbit DIO1 are generally similar to those of rat and human, including:

  • Dual ORD and IRD catalytic abilities

  • PTU sensitivity

  • DTT dependence in vitro

  • Ping-pong reaction kinetics

What are the key considerations when using rabbit DIO1 as a model for human DIO1 in thyroid research?

When using rabbit DIO1 as a model for human research, several important considerations should be kept in mind:

  • Phylogenetic relationship: Rabbit is evolutionarily closer to humans than rodents, potentially making it a more appropriate model for certain aspects of thyroid hormone metabolism.

  • Differential expression patterns: While tissue distribution is generally conserved, quantitative differences in expression levels across tissues may exist between rabbit and human.

  • Response to illness and stress: During critical illness, rabbit DIO1 activity in the liver decreases significantly, similar to the nonthyroidal illness syndrome observed in humans . This makes rabbits a suitable model for studying altered thyroid hormone metabolism in pathological states.

  • Substrate concentration effects: When designing experiments, researchers should consider that physiological substrate concentrations may differ between species, potentially affecting the interpretation of in vitro findings when extrapolating to in vivo situations.

  • Antibody cross-reactivity: Researchers should validate antibody specificity when transitioning between rabbit and human DIO1 studies .

How do mutations in specific residues affect the catalytic properties of recombinant rabbit DIO1?

Mutagenesis studies have revealed that specific amino acid residues critically influence DIO1 catalytic activity across species. Though not specifically documented for rabbit DIO1, studies in other species provide valuable insights applicable to rabbit DIO1 research.

The phenylalanine residue at position 65 (human numbering) is particularly crucial for efficient ORD of reverse T3. When this residue is mutated to leucine, as seen in dog DIO1, the Km for rT3 increases approximately tenfold, substantially reducing catalytic efficiency . This highlights the importance of aromatic residues at this position for interaction with the substrate's inner ring.

Additionally, the region spanning amino acid residues 40-70 contains multiple determinants of substrate specificity. The insertion or deletion of residues corresponding to positions 48-52 in human DIO1 also affects substrate preferences, though to a lesser extent than mutations at position 65 .

For researchers conducting site-directed mutagenesis studies with recombinant rabbit DIO1, these findings suggest key targets for investigation. Systematic mutation of these critical residues can provide insights into structure-function relationships specific to rabbit DIO1.

How can recombinant rabbit DIO1 be utilized to study thyroid hormone metabolism in pathological conditions?

Recombinant rabbit DIO1 serves as a valuable tool for investigating altered thyroid hormone metabolism in pathological conditions:

  • Critical illness models: In critically ill rabbits, hepatic DIO1 activity decreases significantly, correlating with lower plasma and tissue T3 levels. Recombinant DIO1 can be used to study the molecular mechanisms underlying this decreased activity .

  • In vitro substrate utilization studies: Recombinant rabbit DIO1 can be used to assess how pathological alterations in tissue microenvironments (e.g., changes in pH, redox status, or cofactor availability) affect enzyme function.

  • Drug interaction studies: Screening potential medications for effects on DIO1 activity is crucial for understanding drug impacts on thyroid hormone metabolism.

  • Temperature-dependent regulation: Studies comparing recombinant rabbit DIO1 activity across temperature ranges can provide insights into fever-associated alterations in thyroid hormone metabolism .

  • Comparative studies with human DIO1 variants: Parallel experiments with rabbit and human recombinant DIO1 can help identify species-conserved versus species-specific responses to pathological conditions.

What are the technical challenges in optimizing selenocysteine incorporation in recombinant rabbit DIO1 expression systems?

Selenocysteine incorporation presents significant technical challenges in recombinant DIO1 expression:

  • Codon recognition: The UGA codon that encodes selenocysteine is typically recognized as a stop codon by most expression systems, leading to premature termination of translation.

  • SECIS element requirements: Efficient selenocysteine incorporation requires a functional SECIS element in the correct context and distance from the UGA codon.

  • Selenium availability: Expression systems must be supplemented with adequate selenium to ensure sufficient selenocysteine synthesis.

  • Specialized tRNA requirements: Selenocysteine incorporation requires specialized tRNASec and associated translation factors that may be limiting in standard expression systems.

  • Oxidative conditions: Selenocysteine is highly susceptible to oxidation, which can lead to loss of catalytic activity during protein purification.

Strategies to overcome these challenges include:

  • Using mammalian expression systems with endogenous selenoprotein synthesis machinery

  • Co-expressing selenocysteine synthetic pathway components

  • Adding chemical antioxidants during purification

  • Engineering optimized SECIS elements tailored to the expression system

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.