Recombinant Rabbitpox virus Cell surface-binding protein (RPXV102)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RPXV102; Cell surface-binding protein; Carbonic anhydrase homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Rabbitpox virus (strain Utrecht) (RPV)
Target Names
RPXV102
Target Protein Sequence
MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNE YVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIF LQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADA AWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRA ATTSPARDNYFMRWLSDLRETCFSYYQKYIEGNKTFAIIAIVFVFILTAILFLMSRRYSR EKQN
Uniprot No.

Target Background

Function
Binds to chondroitin sulfate on the cell surface, mediating virion attachment to the target cell.
Protein Families
Alpha-carbonic anhydrase family
Subcellular Location
Virion membrane.

Q&A

What is Recombinant Rabbitpox Virus Cell Surface-Binding Protein (RPXV102) and why is it significant in orthopoxvirus research?

Recombinant Rabbitpox Virus Cell Surface-Binding Protein (RPXV102) is a viral protein involved in host cell attachment and entry mechanisms. Its significance stems from its structural and functional similarities to orthologous proteins in variola virus (the causative agent of smallpox). The research importance of RPXV102 lies in its utility as a model for studying poxvirus-host interactions in a controlled laboratory setting.

Methodologically, researchers typically produce RPXV102 through recombinant expression systems, most commonly using baculovirus or bacterial expression vectors with affinity tags for purification. The protein can be characterized through biochemical assays to assess binding properties to various cell types, which provides insights into viral tropism and pathogenesis mechanisms .

How do I establish an effective experimental design for studying RPXV102 binding properties?

Designing effective experiments for studying RPXV102 binding properties requires careful consideration of variables and appropriate controls. Follow these methodological steps:

  • Define your variables clearly - the independent variable would be the concentration or modifications of RPXV102, while the dependent variable would be binding affinity or cellular effects .

  • Write a specific, testable hypothesis - for example, "Recombinant RPXV102 binds to specific cell surface receptors with higher affinity in epithelial cells compared to fibroblasts."

  • Design experimental treatments with appropriate controls:

    • Positive control: Known binding protein with established affinity

    • Negative control: Non-binding protein fragment

    • Vehicle control: Buffer solution without protein

    • Dose-response treatments: Multiple concentrations of RPXV102

  • Determine your experimental approach:

    • For between-subjects design: Use different cell lines for each treatment

    • For within-subjects design: Test the same cell line with different treatments

  • Plan measurement methods:

    • Flow cytometry for quantitative binding assessment

    • Immunofluorescence for localization studies

    • Surface plasmon resonance for binding kinetics analysis

This structured approach ensures methodological rigor and reproducibility in your RPXV102 binding experiments .

What animal models are appropriate for studying RPXV102 in vivo, and what are their limitations?

The New Zealand White (NZW) rabbit model represents the most physiologically relevant system for studying RPXV102 in vivo since rabbitpox naturally infects rabbits. This model offers several methodological advantages:

Intradermal Challenge Model:

  • Rabbits are inoculated with a defined dose of RPXV (typically 300 PFU for high mortality)

  • Disease progression can be monitored through clearly defined biomarkers

  • Blood sampling allows for pharmacokinetic studies and disease monitoring

  • The model recapitulates key features of orthopoxvirus infection in humans

Limitations and Methodological Considerations:

  • Disease progression is temporally compressed compared to human smallpox

  • Age of rabbits influences disease susceptibility (9-week-old rabbits show higher mortality than 16-week-old rabbits)

  • Requires BSL-2 containment facilities

  • Temperature monitoring requires statistical analysis to identify significant fever (defined as 2 standard deviations above baseline)

When designing experiments, researchers should standardize:

  • Age of rabbits (9 vs. 16 weeks shows different mortality)

  • Viral dose (316 PFU resulted in 90-100% mortality)

  • Route of administration (intradermal is standard)

  • Monitoring parameters (temperature, clinical scores, lesion counts, viremia)

How can I develop a standardized method for quantifying RPXV102 binding affinity to different cell types?

Developing a standardized method for quantifying RPXV102 binding affinity requires multifaceted approaches with rigorous controls. Follow this methodological framework:

Protein Preparation Protocol:

  • Express recombinant RPXV102 with a detectable tag (His, FLAG, or fluorescent protein)

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Confirm purity through SDS-PAGE and Western blotting

  • Verify proper folding using circular dichroism spectroscopy

  • Standardize protein concentration through BCA or Bradford assay

Quantitative Binding Assessment:

  • Flow cytometry-based binding assay:

    • Incubate cells with varying concentrations of fluorescently-labeled RPXV102

    • Wash cells thoroughly to remove unbound protein

    • Analyze using flow cytometry to generate binding curves

    • Calculate dissociation constants (Kd) using nonlinear regression

  • Surface Plasmon Resonance (SPR) analysis:

    • Immobilize putative cellular receptors on sensor chips

    • Flow RPXV102 at varying concentrations over the chip

    • Measure association and dissociation rates

    • Calculate binding constants (Ka, Kd) and affinity

Standardization Requirements:

  • Use at least three biological replicates for each cell type

  • Include multiple technical replicates per experiment

  • Incorporate positive controls (known binding partners) and negative controls (non-binding proteins)

  • Normalize binding data to cell surface area or receptor density

  • Validate findings across different methodological approaches

This comprehensive approach allows for robust comparison of RPXV102 binding across different cell types with quantitative precision .

What are the methodological approaches for investigating potential interactions between RPXV102 and host immune factors?

Investigating interactions between RPXV102 and host immune factors requires a multilayered experimental approach that combines in vitro, ex vivo, and in vivo methodologies:

In Vitro Protein-Protein Interaction Studies:

  • Co-immunoprecipitation assays:

    • Incubate tagged RPXV102 with host immune factors

    • Precipitate with tag-specific antibodies

    • Detect interacting partners via Western blotting

  • ELISA-based binding assays:

    • Coat plates with purified immune factors (complement components, antibodies)

    • Add varying concentrations of RPXV102

    • Detect binding using anti-RPXV102 antibodies

    • Generate binding curves for quantitative analysis

  • Biolayer interferometry or SPR:

    • Immobilize either RPXV102 or immune factors

    • Monitor real-time binding kinetics

    • Determine association and dissociation constants

Cellular Immunological Assays:

  • Neutrophil activation assays:

    • Isolate neutrophils from rabbit blood

    • Expose to RPXV102

    • Measure oxidative burst, degranulation, and NET formation

  • Complement inhibition assays:

    • Set up classical complement activation pathways

    • Add RPXV102 at varying concentrations

    • Measure inhibition of complement-mediated lysis

  • Antibody neutralization studies:

    • Generate antibodies against RPXV102

    • Test their ability to neutralize live virus infection

    • Map epitopes recognized by neutralizing antibodies

Ex Vivo Analysis:

  • Use tissue samples from infected rabbits to perform immunohistochemistry

  • Co-localize RPXV102 with immune cell markers

  • Analyze immune cell infiltration in RPXV102-positive tissues

This methodological framework provides a comprehensive analysis of how RPXV102 may modulate host immune responses during infection .

How can I conduct comparative studies between RPXV102 and orthologous proteins from other orthopoxviruses?

Conducting comparative studies between RPXV102 and orthologous proteins from other orthopoxviruses requires a systematic approach focusing on sequence, structure, and functional analyses:

Sequence-Based Comparative Methodology:

  • Multiple sequence alignment:

    • Align RPXV102 with orthologous proteins from variola, vaccinia, monkeypox, and other orthopoxviruses

    • Use MUSCLE or CLUSTAL alignment algorithms

    • Identify conserved domains and variable regions

    • Calculate percent identity and similarity

  • Phylogenetic analysis:

    • Construct phylogenetic trees using Maximum Likelihood or Bayesian methods

    • Bootstrap analysis (>1000 replicates) for statistical confidence

    • Compare evolutionary relationships between orthopoxvirus binding proteins

Structural Comparison Methodology:

  • Protein structure prediction:

    • Generate homology models using I-TASSER or AlphaFold

    • Validate models using Ramachandran plots and QMEAN scores

  • Structural alignment:

    • Superimpose structures using PyMOL or UCSF Chimera

    • Calculate RMSD values for structural divergence

    • Identify key structural differences in binding domains

Functional Comparative Analysis:

  • Binding assay comparison:

    • Express and purify orthologous proteins using identical methods

    • Perform parallel binding assays to the same cell lines

    • Generate comparative binding curves

  • Host range determination:

    • Test binding of RPXV102 and orthologues to cells from different species

    • Correlate binding patterns with known host ranges

  • Immunological cross-reactivity:

    • Generate antibodies against RPXV102

    • Test cross-reactivity with orthologous proteins

    • Map conserved and variable epitopes

Data Integration Table Example:

OrthopoxvirusProteinSequence Similarity to RPXV102 (%)Conserved Binding DomainsCell Binding ProfileHost Range
RabbitpoxRPXV102100AllStrong: rabbit, moderate: humanNarrow
VariolaVARV102~85 (hypothetical)4/5Weak: rabbit, strong: humanNarrow
VacciniaA27L~80 (hypothetical)3/5Moderate: multiple speciesBroad
MonkeypoxMPXV102~90 (hypothetical)4/5Moderate: primate, rodentIntermediate

This comprehensive comparative approach provides insights into both the conserved functions and species-specific adaptations of orthopoxvirus binding proteins .

What methodological approaches are used to evaluate the efficacy of antibodies or small molecules targeting RPXV102 in therapeutic development?

Evaluating therapeutics targeting RPXV102 requires a systematic progression from in vitro screening to in vivo efficacy studies:

In Vitro Screening Methodology:

  • Binding inhibition assays:

    • Pre-incubate RPXV102 with candidate therapeutics

    • Add to target cells

    • Measure reduction in binding compared to controls

    • Calculate IC50 values

  • Virus neutralization assays:

    • Incubate RPXV with therapeutics prior to cell infection

    • Measure plaque reduction or cytopathic effect inhibition

    • Generate neutralization curves

    • Determine EC50 values

  • Time-of-addition studies:

    • Add therapeutics at different time points relative to infection

    • Determine which stage of viral entry is inhibited

    • Confirm specificity for RPXV102-mediated processes

Ex Vivo Tissue Culture Methodology:

  • Use precision-cut rabbit tissue slices

  • Treat with therapeutics before, during, or after RPXV exposure

  • Assess viral spread through immunohistochemistry

  • Measure tissue damage and cytokine responses

In Vivo Therapeutic Evaluation:

  • Setting appropriate triggers for intervention:

    • Fever (temperature >2 standard deviations above baseline)

    • Detection of viremia through qPCR

    • Appearance of ear or back lesions

  • Study design considerations:

    • Use New Zealand White rabbits (16-weeks for more robust evaluation)

    • Challenge with 300-316 PFU RPXV intradermally

    • Begin treatment at pre-defined trigger points

    • Include sham-infected controls and untreated infected controls

    • Monitor clinical signs, lesion count, viremia, and survival

  • Pharmacokinetic/Pharmacodynamic analysis:

    • Collect blood at regular intervals

    • Determine drug concentrations

    • Correlate with viral load reduction

    • Calculate PK/PD parameters (AUC/IC50, Cmax/IC50)

This progression of methodologies allows for comprehensive evaluation of therapeutic candidates targeting RPXV102, with the rabbit model providing a clinically relevant system that has been accepted for regulatory evaluation under the FDA Animal Rule .

How should I design controls and validate experimental results when working with recombinant RPXV102?

Designing robust controls and validation strategies for RPXV102 experiments requires a multi-level approach to ensure scientific rigor:

Essential Controls for RPXV102 Experiments:

  • Protein Quality Controls:

    • Purity control: Include SDS-PAGE and silver staining analysis

    • Structural integrity control: Use circular dichroism spectroscopy

    • Functional control: Verify binding activity to known receptors

    • Tagged protein control: Express tag-only protein to rule out tag-mediated effects

  • Experimental Controls:

    • Positive control: Known cell-binding protein (e.g., vaccinia A27)

    • Negative control: Non-binding viral protein fragment

    • Vehicle control: Buffer solution without protein

    • Concentration controls: Dose-response series

  • Specificity Controls:

    • Competitive inhibition: Pre-incubate with anti-RPXV102 antibodies

    • Receptor blocking: Pre-treat cells with receptor antagonists

    • Cell-type specificity: Test binding on receptor-negative cell lines

Validation Methodologies:

  • Technical Validation:

    • Use at least three independent protein preparations

    • Perform technical replicates (minimum triplicate)

    • Verify results with orthogonal methods (e.g., ELISA and SPR)

  • Biological Validation:

    • Test across multiple cell lines of different origins

    • Validate in primary cells in addition to cell lines

    • Confirm in ex vivo tissue samples when possible

  • Functional Validation:

    • Correlate binding with infection susceptibility

    • Use gene editing to confirm receptor identity

    • Demonstrate that binding inhibition blocks infection

Statistical Validation Framework:

  • Power analysis to determine adequate sample sizes

  • Appropriate statistical tests based on data distribution

  • Multiple test correction for large datasets

  • Blinded analysis where applicable to reduce bias

This comprehensive control and validation strategy ensures reproducible and reliable results when working with recombinant RPXV102, addressing potential artifacts and confirming biological relevance.

What techniques can be used to analyze the structural characteristics of RPXV102 and how do they inform functional studies?

Understanding the structural characteristics of RPXV102 requires an integrated approach using multiple complementary techniques:

High-Resolution Structural Analysis Techniques:

  • X-ray Crystallography:

    • Generate protein crystals of purified RPXV102

    • Collect diffraction data at synchrotron facilities

    • Solve structure through molecular replacement or experimental phasing

    • Refine structure to resolution of 2.5Å or better

    • Define binding domains and potential interaction surfaces

  • Cryo-Electron Microscopy:

    • Prepare RPXV102 grids for single-particle analysis

    • Collect and process image data

    • Generate 3D reconstruction

    • Particularly valuable for RPXV102 in complex with receptors

  • Nuclear Magnetic Resonance Spectroscopy:

    • Isotope-label RPXV102 (15N, 13C)

    • Collect multi-dimensional NMR spectra

    • Determine solution structure

    • Study dynamics of protein regions

    • Identify conformational changes upon binding

Biophysical Characterization Methods:

  • Circular Dichroism Spectroscopy:

    • Analyze secondary structure content (α-helices, β-sheets)

    • Monitor thermal stability and unfolding

    • Assess structural integrity after mutations

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence for tertiary structure analysis

    • Monitor binding-induced conformational changes

    • Determine binding affinities

  • Analytical Ultracentrifugation:

    • Determine oligomeric state

    • Study complex formation with receptors

    • Analyze binding stoichiometry

Structure-Function Correlation Approaches:

  • Epitope Mapping:

    • Generate panel of monoclonal antibodies

    • Map binding epitopes through peptide arrays or HDX-MS

    • Correlate neutralizing epitopes with structural features

  • Site-Directed Mutagenesis:

    • Identify conserved residues from structural analysis

    • Generate point mutations

    • Assess impact on binding and function

    • Create structure-function relationship map

  • Computational Analysis:

    • Molecular dynamics simulations to study flexibility

    • Docking studies with potential receptors

    • Electrostatic surface potential calculation

This methodological framework provides comprehensive structural information that directly informs functional studies by identifying key binding interfaces, conserved structural motifs, and potential therapeutic targeting sites on RPXV102 .

How do I troubleshoot common challenges in RPXV102 expression and purification for experimental use?

Expressing and purifying RPXV102 presents several unique challenges due to its viral membrane protein characteristics. This methodological troubleshooting guide addresses common issues:

Expression System Challenges and Solutions:

  • Insolubility in bacterial systems:

    • Challenge: Formation of inclusion bodies in E. coli

    • Solution: Use solubility tags (MBP, SUMO, TrxA)

    • Alternative: Express as separate domains

    • Validation: Confirm proper folding after tag removal

  • Low yield in mammalian expression:

    • Challenge: Poor expression of full-length RPXV102

    • Solution: Optimize codon usage for mammalian cells

    • Alternative: Use strong promoters (CMV, CAG)

    • Validation: Quantify expression by Western blot

  • Glycosylation heterogeneity:

    • Challenge: Variable glycosylation patterns

    • Solution: Use insect cell (baculovirus) expression

    • Alternative: Create glycosylation site mutants

    • Validation: Analyze glycoform profile by mass spectrometry

Purification Troubleshooting Strategy:

ChallengePossible CauseSolutionValidation Method
Protein degradationProtease activityAdd protease inhibitor cocktailSDS-PAGE analysis
Reduce purification timeWestern blot
Keep samples at 4°CMass spectrometry
Low binding to affinity resinTag inaccessibilityIncrease linker lengthBinding capacity test
Try different tag positionsSmall-scale comparison
Use denaturing conditions with refoldingFunctional assay
Aggregation during concentrationHydrophobic interactionsAdd non-ionic detergentsDynamic light scattering
Reduce concentration rateSize exclusion chromatography
Include stabilizing agents (glycerol, arginine)Thermal shift assay

Quality Control Checkpoints:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (>90% purity)

    • Silver staining for trace contaminants

    • Mass spectrometry for precise identification

  • Structural integrity verification:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assay for stability analysis

    • Limited proteolysis to assess domain folding

  • Functional validation:

    • Cell binding assay compared to native virus

    • Surface plasmon resonance with known interactors

    • Competitive inhibition of viral infection

This systematic troubleshooting approach addresses the major challenges in RPXV102 production while ensuring high-quality protein for experimental applications .

How can RPXV102 research contribute to the development of broad-spectrum antiviral strategies against orthopoxviruses?

RPXV102 research provides a valuable platform for developing broad-spectrum antiviral strategies against orthopoxviruses through several methodological approaches:

Conserved Epitope Identification Methodology:

  • Structural alignment approach:

    • Align RPXV102 structure with orthologous proteins from variola, monkeypox, and vaccinia

    • Identify structurally conserved surfaces across orthopoxviruses

    • Focus on regions essential for viral entry

  • Cross-reactivity screening:

    • Generate antibodies against RPXV102

    • Test neutralization against multiple orthopoxviruses

    • Map broadly neutralizing epitopes

    • Clone and humanize promising antibodies

  • Peptide inhibitor development:

    • Design peptides mimicking conserved receptor-binding regions

    • Test competitive inhibition of viral binding

    • Optimize lead peptides for stability and affinity

    • Evaluate breadth of antiviral activity

Small Molecule Development Framework:

  • High-throughput screening approach:

    • Develop binding assays amenable to HTS format

    • Screen compound libraries against RPXV102

    • Counter-screen hits against orthologous proteins

    • Identify compounds with broad activity spectrum

  • Structure-guided design:

    • Use RPXV102 structural data to identify binding pockets

    • Focus on conserved pockets across orthopoxviruses

    • Perform virtual screening and docking studies

    • Design compounds targeting conserved sites

  • Activity-based probe development:

    • Create covalent inhibitors that bind active sites

    • Use chemical proteomics to confirm target engagement

    • Optimize for specificity and broad orthopoxvirus activity

Therapeutic Evaluation in Animal Models:

  • Rabbitpox model for initial efficacy:

    • Challenge New Zealand White rabbits with RPXV

    • Treat with candidate broad-spectrum antivirals

    • Evaluate against defined clinical endpoints

    • Determine therapeutic window

  • Cross-species validation:

    • Test promising candidates in mouse models with ectromelia

    • Evaluate in non-human primate models with monkeypox

    • Compare efficacy metrics across species

This methodological framework leverages RPXV102 research to develop interventions that target conserved mechanisms across orthopoxviruses, potentially providing protection against emerging threats and bioterrorism agents .

What are the recommended approaches for integrating RPXV102 research with systems biology techniques to understand host-pathogen interactions?

Integrating RPXV102 research with systems biology requires multidisciplinary approaches that capture complex host-pathogen interactions at multiple scales:

Omics-Based Integration Methodologies:

  • Proteomics approach:

    • Affinity purification-mass spectrometry (AP-MS):

      • Express tagged RPXV102 in relevant cell types

      • Isolate protein complexes

      • Identify interacting partners by mass spectrometry

    • Proximity labeling (BioID, APEX):

      • Fuse RPXV102 to biotin ligase

      • Identify proximal proteins in cellular context

      • Map spatial interaction networks

  • Transcriptomics methodology:

    • RNA-seq of infected vs. uninfected cells

    • Compare wild-type virus with RPXV102 deletion mutants

    • Analyze temporal expression changes during infection

    • Identify host response pathways modulated by RPXV102

  • Phosphoproteomics strategy:

    • Monitor signaling changes upon RPXV102 binding

    • Identify phosphorylation cascades triggered by viral attachment

    • Compare with other viral entry proteins

Network Analysis Framework:

  • Protein-protein interaction network construction:

    • Integrate experimental interactome data

    • Add known host-pathogen interactions from databases

    • Apply network visualization tools (Cytoscape)

  • Pathway enrichment analysis:

    • Map interactions to canonical pathways

    • Identify significantly affected biological processes

    • Discover potential intervention points

  • Differential network analysis:

    • Compare network perturbations across conditions

    • Identify condition-specific subnetworks

    • Discover context-dependent interactions

Functional Validation Approaches:

  • CRISPR screening methodology:

    • Genome-wide or focused CRISPR screens

    • Identify host factors required for RPXV102 function

    • Validate hits with individual knockouts

    • Map genetic interactions

  • High-content imaging:

    • Visualize RPXV102 trafficking in real-time

    • Monitor cellular response to binding

    • Quantify morphological changes

    • Perform multiparametric analysis

  • Computational modeling:

    • Develop predictive models of virus-host interactions

    • Simulate perturbations in silico

    • Validate predictions experimentally

This integrated systems biology approach provides a comprehensive understanding of how RPXV102 interfaces with host cellular machinery, revealing potential therapeutic targets and fundamental insights into orthopoxvirus pathogenesis .

What are the key considerations for researchers planning to incorporate RPXV102 studies into broader orthopoxvirus research programs?

Incorporating RPXV102 studies into broader orthopoxvirus research programs requires strategic planning across several dimensions:

Methodological Integration Framework:

  • Align research objectives with regulatory guidance:

    • Consider FDA Animal Rule requirements for countermeasure development

    • Design experiments with translational relevance

    • Establish clearly defined, objective endpoints for therapeutic evaluation

    • Incorporate biomarkers that bridge animal models to human disease

  • Standardize experimental protocols:

    • Use clonal RPXV isolates verified for consistency

    • Standardize challenge doses (300-316 PFU for high mortality)

    • Employ consistent animal models (16-week NZW rabbits for robust evaluation)

    • Develop reproducible readouts for disease progression

  • Implement comparative approaches:

    • Design studies that compare RPXV102 with orthologous proteins

    • Utilize parallel methodologies across different orthopoxviruses

    • Establish correlations between in vitro findings and in vivo outcomes

    • Develop cross-species validation strategies

Research Program Integration Considerations:

  • Biosafety and facility requirements:

    • Establish appropriate containment levels (BSL-2 for RPXV)

    • Consider space requirements for animal studies

    • Develop SOPs for safe handling of infectious materials

    • Train personnel in specialized techniques

  • Collaborative research structure:

    • Identify complementary expertise needs

    • Establish clear data sharing protocols

    • Develop standardized reporting formats

    • Create integration points between research streams

  • Translational pathway planning:

    • Define clear milestones for progression

    • Establish go/no-go decision points

    • Align with regulatory requirements early

    • Consider downstream development needs

By carefully incorporating these methodological and programmatic considerations, researchers can maximize the value of RPXV102 studies within broader orthopoxvirus research initiatives, ensuring scientifically rigorous outcomes with translational impact .

How should researchers interpret and reconcile potential contradictions between in vitro RPXV102 findings and in vivo disease manifestations?

Interpreting and reconciling contradictions between in vitro RPXV102 findings and in vivo observations requires systematic methodological approaches:

Contradiction Analysis Framework:

  • Establish a systematic documentation protocol:

    • Create a structured database of contradictory findings

    • Document experimental conditions in detail

    • Include negative results alongside positive ones

    • Record potential confounding factors

  • Implement parallel validation strategies:

    • Test hypotheses simultaneously in vitro and in vivo

    • Use multiple complementary methodologies

    • Verify findings across different cell types or animal ages

    • Control for species-specific differences

  • Develop mechanistic resolution approaches:

    • Design experiments to specifically address contradictions

    • Test intermediate models (ex vivo tissue slices)

    • Investigate time-dependent effects

    • Consider microenvironmental factors

Common Contradictions and Resolution Methodologies:

Type of ContradictionPossible ExplanationsResolution MethodologyValidation Approach
Binding activity in vitro vs. infection in vivoAccessibility differences in tissuesMicroscopy studies of tissue distributionCompare infected tissue sections with in vitro binding
Multiple entry pathwaysReceptor knockout studiesTest infection in receptor-modified animals
Immune factors present in vivoAdd immune components to in vitro systemsIsolate specific immune factors for testing
Protein function in different cell typesCell-specific cofactorsProteomics to identify interacting partnersCompare interactomes across cell types
Receptor expression levelsQuantitative receptor analysisNormalize findings to receptor density
Post-translational modificationsGlycoproteomic analysisCompare protein modifications
Contradictory results between labsProtocol variationsStandardize protocolsConduct multi-lab validation studies
Reagent differencesUse reference standardsImplement quality control checks
Strain variationsSequence verificationUse clonal virus stocks

Translational Interpretation Guidelines:

  • Prioritize in vivo findings for therapeutic development:

    • Consider the complete physiological context

    • Validate key mechanisms in animal models

    • Use in vitro findings to inform mechanism, not as sole predictors

  • Develop integrated models:

    • Create mathematical models that incorporate multiple datasets

    • Use systems biology approaches to reconcile contradictions

    • Identify contextual factors that explain discrepancies

  • Apply appropriate statistical frameworks:

    • Use Bayesian approaches to update hypotheses with new evidence

    • Implement meta-analysis techniques when appropriate

    • Consider effect sizes alongside statistical significance

This methodological framework provides researchers with systematic approaches to address and resolve contradictions between in vitro RPXV102 findings and in vivo observations, leading to more robust and translatable research outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.