Recombinant Rabbitpox virus Late protein H7 homolog (RPXV094)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rabbitpox Virus Late Protein H7 Homolog (RPXV094)

The Recombinant Rabbitpox virus Late protein H7 homolog (RPXV094) is a protein expressed by the Rabbitpox virus (RPXV), specifically during the late stage of the viral replication cycle . RPXV is a member of the Orthopoxvirus genus, which includes other notable viruses such as the variola virus (the causative agent of smallpox) and vaccinia virus . The H7 homolog protein is involved in the virus's life cycle, though its precise function is not fully elucidated .

Characteristics and Properties

PropertyDescription
Product CodeCSB-CF740856RAD
Uniprot No.Q6RZJ7
Sourcein vitro E. coli expression system
Expression Region1-146
SequenceMEMDKRMKSLAMTAFFGELSTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFE YDNYKA SQYLDLTLTPIFGDECKTHASSIAEQLACADIIKEDISEYIKTTPRLKRFIKKYRNR SDT RISRDTEKLKIALAKGIDYEYIKDAC
Tag InfoN-terminal 10xHis
StorageStore at -20°C; for extended storage, conserve at -20°C or -80°C. Avoid repeated freezing and thawing .

Role in Viral Infection and Immunity

RPXV is highly lethal in rabbits, making it a useful model for studying poxvirus infections and potential therapeutic interventions . Studies indicate that RPXV can lethally infect young rabbits via intradermal routes even at low doses .

The antibody responses to Modified Vaccinia Ankara (MVA) and WR strains of viruses reveal that hyperimmune rabbit MVA sera mainly recognize late virion proteins, suggesting RPXV094 could be one of the key targets for antibody-mediated immunity .

Applications in Vaccine Development

Recombinant viruses, including swinepox virus, expressing viral proteins like VP60 from Rabbit Hemorrhagic Disease Virus (RHDV), have shown promise as effective vaccines in rabbits . The VP60 protein expressed by recombinant swinepox virus self-assembles into virus-like particles (VLPs), inducing high levels of neutralizing antibodies and protecting rabbits from lethal RHDV infection .

Experimental Models and Results

In a study, New Zealand White rabbits were challenged intradermally with RPXV to develop a therapeutic model for poxvirus infections . The time course from RPXV inoculation to abnormal parameters, such as fever, viremia, and pox lesions, and eventual death were closely monitored. Statistical analysis of these parameters revealed significant differences between 9-week-old and 16-week-old RPXV-infected rabbits .

Parameter9-Week-Old Rabbits16-Week-Old Rabbits
SurvivalLowerHigher
Time to FeverLongerShorter
ViremiaNo significant differenceNo significant difference
Pox LesionsNo significant differenceNo significant difference
Time to DeathNo significant differenceNo significant difference

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its inclusion.
Synonyms
RPXV094; Late protein H7 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Rabbitpox virus (strain Utrecht) (RPV)
Target Names
RPXV094
Target Protein Sequence
MEMDKRMKSLAMTAFFGELSTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDNYKA SQYLDLTLTPIFGDECKTHASSIAEQLACADIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC
Uniprot No.

Target Background

Function

Contributes to the formation of crescents and immature virions (IV).

Protein Families
Chordopoxvirinae H7 family
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.