Recombinant Ralstonia metallidurans 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ralstonia metallidurans 4-Hydroxybenzoate Octaprenyltransferase (ubiA)

Recombinant Ralstonia metallidurans 4-hydroxybenzoate octaprenyltransferase, encoded by the gene ubiA, is a crucial enzyme involved in the biosynthesis of ubiquinone, a vital component in the electron transport chain of bacteria. This enzyme catalyzes the transfer of an octaprenyl group to 4-hydroxybenzoate, a key step in the synthesis of ubiquinone. The recombinant form of this enzyme is produced in Escherichia coli and is used for various biochemical studies and applications.

Characteristics of Recombinant Ralstonia metallidurans 4-Hydroxybenzoate Octaprenyltransferase (ubiA)

  • Source and Production: The recombinant enzyme is produced in E. coli, using the genetic material from Ralstonia metallidurans (previously known as Cupriavidus metallidurans) .

  • Purity and Stability: The enzyme is purified to a level of >85% as determined by SDS-PAGE. It is stable when stored at -20°C or -80°C, with a shelf life of 6 months in liquid form and 12 months in lyophilized form .

  • Function: This enzyme is essential for the biosynthesis of ubiquinone by transferring an octaprenyl group to 4-hydroxybenzoate.

Biochemical Properties

  • Optimal Conditions: While specific optimal conditions for the recombinant Ralstonia metallidurans enzyme are not detailed, related enzymes like those from E. coli are known to be optimal at pH 7.8 and require magnesium ions for activity .

  • Substrate Specificity: The enzyme typically accepts all-trans-octaprenyl diphosphate as the prenyl donor, although specific Km values for this recombinant form are not provided.

Research Findings and Applications

  • Ubiquinone Biosynthesis: The enzyme plays a critical role in the synthesis of ubiquinone, which is essential for bacterial energy metabolism and electron transport .

  • Biotechnological Applications: Recombinant enzymes like this can be used in biotechnological applications, such as the production of ubiquinone analogs or in studies related to bacterial metabolism and energy production.

Table 1: Characteristics of Recombinant Ralstonia metallidurans 4-Hydroxybenzoate Octaprenyltransferase (ubiA)

CharacteristicDescription
SourceE. coli
Purity>85% (SDS-PAGE)
Storage Conditions-20°C or -80°C
Shelf Life6 months (liquid), 12 months (lyophilized)
FunctionUbiquinone biosynthesis

Recombinant Ralstonia metallidurans 4-hydroxybenzoate octaprenyltransferase (ubiA) is a valuable tool for studying ubiquinone biosynthesis and has potential applications in biotechnology. Further research into its biochemical properties and applications could enhance our understanding of bacterial metabolism and energy production pathways.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please specify your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
ubiA; Rmet_2939; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
ubiA
Target Protein Sequence
MSHPSTAPAHPSRLALYARLVRIDKPIGTLLLLWPTLWAMWMAAGGPPGWTLFWIFFAGT FLMRSAGCAMNDWADRDFDKHVKRTKERPLTAGLIASWEALAVAAVLALIALALILPLNA LTKWLAVVAAVLAGTYPFFKRFFAIPQAYLGIAFGFGIPMAFAAIQDQVPFVAWLMLLAN VFWAIAYDTAYAMVDRDDDLLLGMKTSAITFGRFDVAAIMICYAVFLGLMAWAGSLLGLG WPYYAGLVAAAGMAGYHYTLIRERDRMKCFAAFRHNNWLGACVFAGTFVAYLLK
Uniprot No.

Target Background

Function
4-hydroxybenzoate octaprenyltransferase (UbiA) from *Ralstonia metallidurans* catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. This enzyme mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.