Recombinant Ralstonia metallidurans Cobalt-zinc-cadmium resistance protein CzcD (czcD)

Shipped with Ice Packs
In Stock

Description

Functional Role in Heavy Metal Resistance

CzcD operates within the Czc resistance system, which includes the CzcCBA tripartite efflux pump. Key functions include:

  • Cation efflux: Mediates low-level resistance by exporting Co²⁺, Zn²⁺, and Cd²⁺ via proton gradient-driven transport .

  • Regulatory control: Represses transcription of czcCBA genes by reducing intracellular inducer concentrations. Deletion of czcD leads to constitutive czcCBA expression .

  • Synergy with other systems: Collaborates with P-type ATPases (e.g., CadA, ZntA) and CDF proteins (e.g., DmeF) for periplasmic detoxification .

Table 2: Metal Binding and Transport Affinities

Metal IonBinding CapacityApparent Kₘ (μM)Resistance Contribution
Zn²⁺High1.4Primary substrate
Co²⁺ModerateN/ASecondary substrate
Cd²⁺LowN/ATertiary substrate

Mechanism of Regulation

CzcD’s regulatory role is tied to its metal transport activity:

  • Repression of CzcCBA: By exporting inducers (Zn²⁺, Co²⁺, Cd²⁺), CzcD prevents their accumulation in the cytoplasm, thereby downregulating czcCBA expression .

  • Cross-species functionality: Complements czcD-null mutants in Ralstonia and shares functional homology with yeast CDF proteins ZRC1p and COT1p .

Key Experimental Insights:

  • Gene deletion studies:

    • ΔczcD mutants exhibit 6-fold reduced Zn²⁺ resistance and 350-fold reduced Cd²⁺ resistance in R. metallidurans AE104 .

    • Double deletion of czcD and dmeF (another CDF gene) renders the CzcCBA pump nonfunctional against Co²⁺, indicating interdependence .

  • Expression dynamics:

    • CzcD reduces cytoplasmic metal concentrations, indirectly suppressing cadA and zntA ATPase transcription .

    • Overexpression in E. coli enhances Zn²⁺ resistance by 65% through reduced cellular accumulation .

Table 3: Resistance Levels in Mutant Strains

StrainCo²⁺ MIC (mM)Zn²⁺ MIC (mM)Cd²⁺ MIC (mM)
Wild-type CH344.512.00.5
ΔczcD2.32.00.1
ΔdmeF ΔczcD (pMOL30)<0.004N/AN/A
ΔcadA ΔzntA (CzcCBA active)4.512.00.2

Open Questions and Future Directions

  • Structural dynamics: Precise transmembrane topology and metal-binding coordination remain unresolved .

  • Biotechnological potential: Engineering CzcD for bioremediation or biosensor development requires further kinetic profiling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
czcD; Rmet_5979; Metal cation efflux system protein CzcD; Cobalt-zinc-cadmium resistance protein CzcD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
czcD
Target Protein Sequence
MGAGHSHDHPGGNERSLKIALALTGTFLIAEVVGGVMTKSLALISDAAHMLTDTVALAIA LAAIAIAKRPADKKRTFGYYRFEILAAAFNALLLFGVAIYILYEAYLRLKSPPQIESTGM FVVAVLGLIINLISMRMLSSGQSSSLNVKGAYLEVWSDLLGSVGVIAGAIIIRFTGWAWV DSAIAVLIGLWVLPRTWILLKSSLNVLLEGVPDDVDLAEVEKQILATPGVKSFHDLHIWA LTSGKASLTVHVVNDTAVNPEMEVLPELKQMLADKFDITHVTIQFELAPCEQADAAQHFN ASPALVGSKSLAAGGN
Uniprot No.

Target Background

Function
CzcD, the Cobalt-zinc-cadmium resistance protein, mediates a low-level metal ion resistance. Its function is primarily attributed to the efflux of cations from the cytoplasm into the periplasm. It also contributes to resistance against cobalt, cadmium, and zinc by regulating the Czc system. CzcD may repress the expression of the Czc system by exporting inducing cations. This protein binds and transports zinc, and can also bind cobalt, copper, and nickel.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of CzcD protein in Ralstonia metallidurans?

CzcD from Ralstonia metallidurans is a membrane-bound protein belonging to the cation diffusion facilitator (CDF) family. Structural analysis reveals that CzcD contains at least four transmembrane α-helices (designated I, II, III, and IV). The protein has a cytoplasmic localization of its N-terminus and the regions between helices II and III, as well as downstream of helix IV. After these four spans (at fusion position Y152), two more hydrophobic peaks occur, though their exact membrane topology is less clear. Fusion studies at position S203 after both peaks strongly indicate a cytoplasmic localization, while two independent fusions between both peaks (T175 and W177) did not provide evidence for a periplasmic localization .

Histidine residues in CzcD are involved in the binding of 2 to 3 mol of Zn²⁺ per mol of protein, suggesting their crucial role in metal coordination. When purified as an amino-terminal streptavidin-tagged protein, CzcD demonstrated binding affinity for Zn²⁺, Co²⁺, Cu²⁺, and Ni²⁺, but notably did not bind Mg²⁺, Mn²⁺, or Cd²⁺ in metal affinity chromatography experiments .

How does the CzcD protein function in heavy metal resistance mechanisms?

CzcD functions through two primary mechanisms in heavy metal resistance:

  • Direct Metal Transport: CzcD mediates the export of metal ions (particularly zinc, cobalt, and cadmium) out of the bacterial cell. Expression of the czcD gene in an E. coli mutant strain lacking zitB and zntA (genes for other zinc transporters) rendered the strain more zinc-resistant and caused decreased accumulation of zinc . This indicates CzcD's direct role in metal efflux.

  • Regulatory Function: CzcD plays a critical role in regulating the expression of the CzcCBA efflux system. Deletion of czcD in Ralstonia sp. resulted in partially constitutive expression of the Czc system due to increased transcription of the structural czcCBA genes, both in the absence and presence of inducers. Specifically, the mRNA level in the czcD deletion strain was 10-fold higher than in the wild-type strain under both non-induced and induced conditions . This suggests that CzcD represses czc induction either by inducer exclusion or through protein-protein interactions.

The experimental evidence clearly shows that CzcD provides a small but significant resistance to cobalt, zinc, and cadmium in Ralstonia based on reduced accumulation of these cations .

What experimental methods are used to study metal binding properties of CzcD?

Several experimental methods have been employed to characterize the metal binding properties of CzcD:

  • Metal Affinity Chromatography: This technique revealed that purified amino-terminal streptavidin-tagged CzcD binds Zn²⁺, Co²⁺, Cu²⁺, and Ni²⁺ but not Mg²⁺, Mn²⁺, or Cd²⁺ .

  • Radioisotope Transport Assays: Using ⁶⁵Zn²⁺ and everted membrane vesicles, researchers can measure transport activity. Similar experiments with the related protein ZitB demonstrated zinc transport in the presence of NADH with an apparent Km of 1.4 μM and a Vmax of 0.57 nmol of Zn²⁺ min⁻¹ mg of protein⁻¹ .

  • Site-Directed Mutagenesis: By mutating conserved amino acyl residues potentially involved in binding and transport of zinc, researchers can assess their influence on metal binding capacity .

  • Complementation Studies: The function of CzcD can be assessed by complementing czcD deletion with various CDF proteins (including those from other organisms like ZRC1p and COT1p from Saccharomyces cerevisiae) and measuring the resulting metal resistance .

  • Metal Accumulation Assays: Measuring the intracellular concentration of metals in wild-type versus deletion strains or strains expressing recombinant CzcD provides evidence of transport activity .

How do mutations in conserved amino acid residues affect the metal transport activity of CzcD?

Conserved amino acid residues play crucial roles in the metal transport activity of CzcD, with mutations potentially affecting binding affinity, transport kinetics, or substrate specificity. Research has shown that histidine residues are particularly important, being involved in the binding of 2 to 3 mol of Zn²⁺ per mol of CzcD protein .

A methodological approach to studying the effects of mutations involves:

  • Identification of Conserved Residues: Sequence alignment of multiple CDF family proteins identifies highly conserved residues across species.

  • Site-Directed Mutagenesis: Targeted mutations of these conserved residues, particularly focusing on:

    • Histidine residues involved in zinc coordination

    • Charged residues in transmembrane domains that may form a transport pathway

    • Residues at the interface between helices that may participate in conformational changes

  • Functional Assays:

    • Metal resistance assays comparing wild-type and mutant proteins

    • Transport assays using radioisotopes like ⁶⁵Zn²⁺ in everted membrane vesicles

    • Metal binding assays using purified proteins

    • Measurement of metal accumulation in cells expressing mutant proteins

For example, in the related CDF protein ZitB, mutations in conserved amino acyl residues affected zinc transport capability. Similar approaches could be applied to CzcD to elucidate structure-function relationships and identify specific residues critical for metal selectivity and transport efficiency .

What experimental approaches would best elucidate the interaction between CzcD and the CzcCBA efflux system?

Understanding the interaction between CzcD and the CzcCBA efflux system requires a multi-faceted experimental approach:

  • Genetic Interaction Studies:

    • Construction of single and double deletion mutants (ΔczcD, ΔczcCBA, and ΔczcD/ΔczcCBA)

    • Complementation studies with wild-type and mutant proteins

    • Measurement of metal resistance profiles in different genetic backgrounds

  • Gene Expression Analysis:

    • Quantitative RT-PCR to measure czcCBA expression levels in wild-type and ΔczcD strains under various metal concentrations, as previously done where mRNA levels in the deletion strain were 10-fold higher than in the wild-type strain

    • Reporter gene fusions (such as β-galactosidase) to monitor induction patterns, similar to studies showing higher β-galactosidase activity in uninduced cells of ΔczcD strains

    • RNA-seq to identify all genes affected by czcD deletion

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation of CzcD with components of the CzcCBA system

    • Bacterial two-hybrid assays to screen for interactions

    • Fluorescence resonance energy transfer (FRET) using fluorescently tagged proteins to detect interactions in vivo

  • Metal Transport Measurements:

    • Comparison of metal efflux rates in cells with varying levels of CzcD and CzcCBA

    • Metal accumulation assays under different expression conditions

  • Structural Biology Approaches:

    • Cryo-electron microscopy of membrane preparations containing both systems

    • Cross-linking studies followed by mass spectrometry to identify interaction sites

These approaches would help determine whether CzcD regulates CzcCBA through direct protein interactions or indirectly through modulation of intracellular metal concentrations that act as inducers.

How can central composite design (CCD) be applied to optimize experimental conditions for studying CzcD function?

Central Composite Design (CCD) is a powerful statistical approach for optimizing multiple experimental parameters simultaneously. For studying CzcD function, CCD can be applied as follows:

  • Optimization of Expression Conditions:

    • Factors to consider: temperature, inducer concentration, expression time, media composition

    • Response variables: protein yield, solubility, activity

    • A CCD would generate an experimental matrix covering combinations of these factors at different levels, including center points and star points

  • Transport Assay Optimization:

    • Factors: pH, buffer composition, metal ion concentration, competing ions, energy source concentration

    • Response variable: transport rate

    • The design would utilize factorial points, center points, and star points to model the response surface

  • Metal Binding Study Design:

    • Factors: pH, temperature, ionic strength, protein concentration

    • Response variable: binding affinity or capacity

Implementing a CCD requires:

  • Selecting k factors (experimental variables)

  • Creating a design with 2ᵏ factorial points, 2k star points, and center points

  • The star points represent new extreme values (low and high) for each factor

For example, a two-factor CCD for optimizing CzcD metal binding assays might include:

  • 4 factorial points (combinations of high/low pH and temperature)

  • 4 star points (very high/very low pH and temperature)

  • 5 center points (intermediate pH and temperature)

The resulting data would allow fitting of a quadratic model to identify optimal conditions and potential interactions between factors, greatly improving experimental efficiency compared to one-factor-at-a-time approaches.

What are the optimal expression systems for producing recombinant CzcD for structural studies?

Selecting an optimal expression system for CzcD is critical for structural studies, as this membrane protein requires proper folding and insertion into membranes. Based on research approaches with similar proteins:

  • Escherichia coli-Based Systems:

    • pET Expression System: Offers high-level expression under T7 promoter control. For CzcD, using E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression is advantageous.

    • Fusion Tags: N-terminal streptavidin tags have been successfully used for CzcD purification , while His-tags facilitate purification via nickel affinity chromatography.

    • Codon Optimization: Adapting the R. metallidurans czcD gene sequence to E. coli codon usage can improve expression.

  • Alternative Expression Hosts:

    • Lactococcus lactis: Provides a gram-positive expression system with simplified membrane structure.

    • Pichia pastoris: A eukaryotic system that can produce high yields of membrane proteins with proper folding.

    • Cell-Free Expression Systems: Allow direct insertion into supplied lipid environments.

  • Expression Optimization:

    • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding.

    • Induction: Mild induction with lower IPTG concentrations (0.1-0.5 mM) over longer periods.

    • Media Supplements: Addition of specific lipids or metal ions that may stabilize the protein.

  • Purification Strategy:

    • Detergent Screening: Systematic testing of different detergents for solubilization (DDM, LMNG, etc.).

    • Lipid Nanodiscs or Amphipols: For stabilizing the protein in a more native-like environment.

For structural studies specifically, expression constructs should be designed to remove flexible regions that might impede crystallization or cause heterogeneity in cryo-EM samples, while preserving the core functional domains and transmembrane segments identified through topology studies .

How can we design experiments to measure the kinetics of CzcD-mediated metal transport in membrane vesicles?

Measuring the kinetics of CzcD-mediated metal transport requires careful experimental design:

  • Preparation of Membrane Vesicles:

    • Everted Vesicles: Prepare from E. coli expressing recombinant CzcD using French press or sonication techniques, allowing measurement of metal uptake (which represents efflux in intact cells).

    • Right-side-out Vesicles: Prepare by osmotic shock methods for studying transport in the physiological direction.

    • Quality Control: Assess vesicle orientation using enzyme markers and size using dynamic light scattering.

  • Transport Assay Design:

    • Radioisotope Method: Use ⁶⁵Zn²⁺, ⁶⁰Co²⁺, or ¹⁰⁹Cd²⁺ to track metal movement with high sensitivity.

    • Energy Source: Include NADH (as used with ZitB showing Km of 1.4 μM and Vmax of 0.57 nmol of Zn²⁺ min⁻¹ mg⁻¹) or ATP depending on the transport mechanism.

    • Rapid Filtration: Use for time-course measurements, separating vesicles from external media at defined time points.

    • Metal Concentration Range: Test multiple concentrations (typically 0.1-100 μM) to determine Km and Vmax.

  • Kinetic Analysis:

    • Initial Rate Measurements: Focus on the linear portion of transport curves.

    • Michaelis-Menten Analysis: Plot initial rates vs. metal concentration to determine Km and Vmax.

    • Inhibition Studies: Test effects of competing metals, ionophores, or energy inhibitors.

    • pH Dependence: Measure transport rates across a pH range to determine optimal conditions and proton coupling.

  • Controls and Validation:

    • Empty Vector Controls: Determine background transport rates.

    • Inactive Mutants: Use site-directed mutants as negative controls.

    • Ionophores: Verify vesicle integrity using gramicidin or valinomycin.

These methods parallel those used successfully with the related protein ZitB, which demonstrated zinc transport in everted membrane vesicles with defined kinetic parameters , and can be adapted for comprehensive characterization of CzcD transport kinetics for various metal substrates.

What are the best approaches for creating and validating czcD deletion mutants in Ralstonia metallidurans?

Creating and validating czcD deletion mutants requires precise genetic manipulation techniques:

  • Gene Deletion Strategies:

    • Homologous Recombination: Design constructs with homology arms flanking czcD, replacing the gene with an antibiotic resistance marker.

    • CRISPR-Cas9 System: Design guide RNAs targeting czcD and provide a repair template for marker insertion or scarless deletion.

    • Suicide Vector Approach: Use non-replicating plasmids in R. metallidurans carrying the deletion construct and antibiotic resistance marker.

  • Selection and Screening:

    • Antibiotic Selection: Initial selection on appropriate antibiotics.

    • PCR Verification: Primers flanking the deletion site to confirm gene removal.

    • Sequencing: Verify the precise junction regions of the deletion.

  • Phenotypic Validation:

    • Metal Resistance Assays: Compare MICs for zinc, cadmium, and cobalt between wild-type and deletion strains. Previous research showed deletion strains produced only a few single colonies on solid medium with zinc while wild-type strains displayed full growth .

    • Growth Curves: Monitor growth in the presence of different metal concentrations. Studies have shown that ΔczcD deletion strains grow without a lag phase in media containing 2.5 mM Zn²⁺ regardless of pre-adaptation, while wild-type strains only grow without lag when pre-adapted with 300 μM Zn²⁺ .

    • Metal Accumulation: Measure intracellular metal concentrations to confirm altered metal homeostasis.

  • Molecular Validation:

    • Gene Expression Analysis: Quantify czcCBA mRNA levels using RT-PCR or RNA-seq. Previous work demonstrated 10-fold higher czcCBA mRNA in deletion strains compared to wild-type under both induced and uninduced conditions .

    • Reporter Gene Assays: Use β-galactosidase reporter constructs to monitor expression of regulated genes. Studies showed β-galactosidase activity in uninduced cells of ΔczcD strains was twice as high as in uninduced wild-type cells .

  • Complementation Studies:

    • Express czcD in trans from a plasmid in the deletion strain to confirm restoration of wild-type phenotypes.

    • Use related CDF proteins (like ZRC1p and COT1p from S. cerevisiae) to test functional conservation .

The table below summarizes the expression levels observed in previous studies comparing wild-type and ΔczcD strains:

Bacterial strainGenotypecDNA concentration (ng/g of RNA)Fold induction
Uninduced cellsInduced cells
AE128(pMOL30)Wild type6, 16762, 84674
DN182(pMOL30-14)Δ czcD106, 2684,950, 10,15042

Note: Cells were induced with 300 μM Zn²⁺ for 10 minutes before RNA isolation .

How can we resolve contradictions in data regarding CzcD's metal binding specificity?

Resolving contradictions in metal binding specificity data for CzcD requires systematic investigation:

  • Reconciling Contradictory Findings:
    One key contradiction in the existing data is that while CzcD provides resistance to cadmium in vivo, purified CzcD protein did not bind Cd²⁺ in metal affinity chromatography experiments . Several experimental approaches can address this:

    • Comparison of In Vitro vs. In Vivo Conditions: Systematically vary pH, redox state, and the presence of other cellular components that might affect metal binding.

    • Alternative Binding Assays: Employ isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or fluorescence spectroscopy as complementary methods to metal affinity chromatography.

    • Structural Studies: Determine if CzcD undergoes conformational changes upon metal binding that might explain different affinities in different contexts.

    • Binding Site Mutants: Create mutations in predicted metal-binding sites to determine if separate sites exist for different metals.

  • Metal Specificity Analysis:

    • Competition Assays: Study the ability of different metals to compete for binding or transport, which can reveal preference hierarchies.

    • Transport vs. Binding: Separately measure binding affinity and transport rates for different metals to determine if binding strength correlates with transport efficiency.

  • Regulatory Context:

    • Indirect Effects: Investigate whether CzcD's effect on cadmium resistance might be primarily through regulation of other transporters like CzcCBA rather than direct cadmium transport.

    • Protein Interactions: Study potential interactions with other metal-handling proteins that might affect in vivo metal specificity.

This systematic approach would help reconcile the apparent contradiction between CzcD's role in cadmium resistance and its in vitro binding specificity.

What are the implications of recent AI use in academic research surveys for studies on bacterial metal resistance mechanisms?

The increasing use of AI in academic research, particularly in survey responses, raises important considerations for researchers studying bacterial metal resistance mechanisms:

These considerations are particularly relevant for meta-research studies examining research practices, methodological challenges, or consensus views in the field of bacterial metal resistance mechanisms.

How does the interplay between CzcD and other metal resistance systems impact experimental design?

Understanding the interplay between CzcD and other metal resistance systems is crucial for experimental design:

  • Systems Biology Approach:
    R. metallidurans employs multiple mechanisms for metal resistance, including CzcD, the CzcCBA efflux pump, and P-type ATPases like CadA and ZntA . Effective experimental design must account for this complexity:

    • Genetic Background Selection: Experiments should be conducted in appropriate genetic backgrounds where specific components are systematically deleted or controlled.

    • Redundancy Considerations: Single deletion mutants may show minimal phenotypes due to functional redundancy, as observed with cadA and zntA deletions which individually had moderate effects but together decreased zinc resistance 6-fold and cadmium resistance 350-fold .

    • Plasmid Context: Consider that the czcCBA genes are located on plasmid pMOL30 while cadA and zntA are on the bacterial chromosome , which affects genetic manipulation strategies.

  • Multi-level Experimental Design:

    • Transcriptional Interactions: Design experiments to capture how CzcD affects expression of other metal resistance genes.

    • Metal Concentration Ranges: Test wide concentration ranges to distinguish between high-affinity and low-affinity transport systems.

    • Metal Specificity Overlap: Account for overlapping metal specificities when designing metal challenge experiments.

  • Physiological Context:

    • Growth Conditions: Standard laboratory media may contain trace metals that affect baseline expression of resistance systems.

    • Adaptation Periods: Include pre-adaptation steps in experimental protocols, as metal handling systems show different responses in pre-adapted versus non-adapted cells .

    • Cellular Metal Quotas: Measure total cellular metal content as a function of external metal concentration to understand homeostasis mechanisms.

This comprehensive approach accounts for the complex interplay between CzcD and other metal resistance systems, ensuring more robust and interpretable experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.