Recombinant Ralstonia metallidurans Cobalt-zinc-cadmium resistance protein CzcN (czcN)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

The Recombinant Ralstonia metallidurans Cobalt-Zinc-Cadmium Resistance Protein CzcN (czcN) is a recombinant protein derived from Cupriavidus metallidurans (formerly Ralstonia metallidurans), a metallophilic β-proteobacterium known for its exceptional ability to thrive in environments with high concentrations of toxic metals like cobalt (Co), zinc (Zn), and cadmium (Cd) . CzcN is a component of the czc operon, a plasmid-encoded metal resistance system critical for detoxifying these metals via efflux mechanisms .

Regulatory Mechanisms

3.1. Promoter Regulation
CzcN is transcriptionally regulated by:

  • CzcR: A response regulator that binds to czcNp and activates transcription in the presence of Zn(II) or Cd(II) .

  • Metal-Responsive Elements: The czcNp promoter is induced >250-fold under metal stress (e.g., 500 μM Zn(II)) .

RegulatorInteraction with czcNpKey MetalsReference
CzcRBinds to czcNp; cooperative binding at low ZnZn, Cd
CzcSPhosphorylates CzcR; senses periplasmic metalsZn, Cd, Co
CzcEPeriplasmic metal-binding protein; modulates czcNp activityZn, Cd, Co

3.2. Cross-Talk with Other Systems
CzcN integrates with the ZntR/ZntA (zinc efflux) and CadR/CadA (cadmium efflux) systems to maintain metal homeostasis . In C. metallidurans, CzcCBA dominates at high metal concentrations, while ZntA and CadA handle moderate levels .

Research Findings and Applications

4.1. Proteomic and Functional Studies

  • Metal Stress Response: Under metal shock (e.g., Zn, Cd, Co), CzcN abundance increases 10-fold, aligning with upregulated czc operon activity .

  • Gene Deletion Effects: Deletion of czcN reduces cadmium resistance by 350-fold in plasmid-free strains, highlighting its regulatory role .

StrainMIC (mM)ZnCl₂CdCl₂CoCl₂Reference
Wild-type CH347.02.05.0
ΔczcI (plasmid)10.02.57.5

4.2. Biotechnological and Diagnostic Use

  • Recombinant Protein: Used in ELISA assays, structural studies, and metal-binding assays .

  • Bioremediation: Insights into CzcN’s role could inform strategies for metal detoxification in contaminated soils .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To prioritize a specific tag, please inform us accordingly.
Synonyms
czcN; Rmet_5984; Cobalt-zinc-cadmium resistance protein CzcN; Cation efflux system protein CzcN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
czcN
Target Protein Sequence
MTDSSISPSHPAGLSRALDNFLTRHRIGVWRVVVTFVLASLLFGHSRWDGTWVSPLLLTL GMLGVSLATVGRLWCALYISGRKNNTLVTSGPYSLCRHPLYVCNLLGILGLGAMTESLAV TAVLALAFALMYPAVIRTEDRFLASAFPEFAEYARRTPAFFPRLSLYRGESTWTVHVSSF QRNIADSVWFLGLSVVVESFDLFHDAGVLRAVVTLA
Uniprot No.

Target Background

Function
A component of the CZC cation efflux system, conferring resistance to cobalt, zinc, and cadmium.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Czc metal resistance system in Ralstonia metallidurans?

The Czc system is a sophisticated metal homeostasis mechanism in Ralstonia metallidurans (also known as Cupriavidus metallidurans) that adjusts periplasmic zinc, cobalt, and cadmium concentrations, thereby influencing subsequent uptake of these metals into the cytoplasm. This system functions as a protective "shield" against toxic metal concentrations, working alongside other metal resistance mechanisms like the P-type ATPases. The main components include the CzcCBA efflux pump (encoded on plasmid pMOL30) that mediates resistance to Co²⁺, Zn²⁺, and Cd²⁺, regulatory proteins such as CzcI, and associated systems like ZntA and CadA ATPases that provide additional layers of defense .

How does CzcN relate to other components of the Czc system?

CzcN functions within the broader Czc metal resistance network, which includes the well-characterized CzcCBA transenvelope efflux system. While the CzcCBA complex forms the core transport machinery, CzcN likely plays a regulatory or auxiliary role in this system. The system includes other components such as CzcI and CzcI₂, which appear to decrease Czc-mediated metal resistance, possibly to prevent "overexcretion" of periplasmic zinc ions that could result in zinc starvation due to diminished zinc uptake into the cytoplasm . This interconnected system demonstrates how multiple proteins work together to maintain metal homeostasis.

What is the genetic organization of the czc determinant in R. metallidurans?

The czc determinant in R. metallidurans shows a complex genetic organization spread across different genetic elements. The core czcCBA genes are located on plasmid pMOL30, while related components like zntA are located on the chromid adjacent to czcI₂C₂B₂' . This organization reveals the genetic distribution of metal resistance determinants: plasmid-borne elements provide specialized resistance capabilities that can potentially be transferred between bacteria, while chromosomal components like the P-type ATPases (zntA and cadA) provide foundational resistance mechanisms . The genetic context of czcN would be expected to reflect its functional relationship with other czc components.

How is the expression of the Czc system regulated in response to metal exposure?

The Czc system displays a sophisticated regulatory network responding to metal concentrations. ZntR (Rmet_3456), a MerR-type regulator, has been identified as the main regulator of zntA expression, which is induced by both zinc and cadmium . Similarly, CadR (Rmet_2302) regulates cadA expression, which is primarily induced by cadmium but can also be induced by zinc when zntA is absent . This cross-regulation creates a hierarchical response system where different components are activated at specific metal concentration thresholds. Interestingly, expression of both zntA and cadA is diminished in the presence of CzcCBA, indicating that CzcCBA efficiently decreases cytoplasmic cadmium and zinc concentrations, creating a feedback loop that modulates the system's response .

What is the interplay between the CzcCBA efflux system and P-type ATPases in metal resistance?

The relationship between the CzcCBA system and P-type ATPases (ZntA and CadA) represents a sophisticated multi-layered defense strategy against toxic metals. Experimental evidence shows that in plasmid-free R. metallidurans strain AE104, single gene deletions of cadA or zntA had only moderate effects on cadmium and zinc resistance, but zinc resistance decreased 6-fold and cadmium resistance decreased 350-fold in double deletion strains . Notably, neither single nor double gene deletions affected zinc resistance in the presence of czcCBA, while cadmium resistance of the cadA zntA double mutant could be elevated only partially by CzcCBA . This indicates a hierarchical arrangement where CzcCBA provides the primary defense against zinc toxicity, while both systems are needed for maximal cadmium resistance .

What quantitative models explain the functioning of the Czc system?

Quantitative models have been developed to explain heavy metal resistance in R. metallidurans. The flow equilibrium model describes the cytoplasmic content of metal ions as an interaction between cation uptake and CzcCBA-mediated efflux. This model uses experimentally determined uptake velocities and CzcA protein levels (determined by Western blot) to predict metal resistance patterns . An alternative model based on modified Freundlich's equation describes binding of heavy metals to inactivated R. metallidurans cells. These complementary models can describe cadmium resistance in growing cells (flow equilibrium model) and early stationary cells (combined binding and flow equilibrium models) . The quantitative modeling reveals how physiological events in growing cells can be simulated using the biochemical data of interacting transport proteins.

What experimental methods are used to study CzcN and the Czc system?

Several complementary experimental approaches are essential for studying the Czc system components:

MethodApplicationKey Insights
Gene deletionFunctional characterizationSingle and double deletions of czcI genes increased cobalt resistance
Expression in heterologous hostsProtein functionExpression of zntA and cadA in E. coli showed their metal specificity
Reporter gene fusionsExpression patternslacZ fusions revealed induction patterns of cadA and zntA
Western blotProtein quantificationUsed to determine CzcA protein levels for quantitative modeling
Metal content determinationResistance mechanismMeasured cellular metal content to validate quantitative models
Cloning and plasmid constructionComplementation studiesUsed to analyze if CzcI₂ interferes with CzcCBA

These methodologies provide a multi-faceted approach to understanding the complex interrelationships between Czc system components under different metal stress conditions.

How can genetic modifications be used to analyze CzcN function?

Genetic modification strategies offer powerful tools for functional characterization of Czc system components. Similar to studies of CzcI, researchers can create knockout mutants of czcN in different genetic backgrounds (plasmid-containing wild-type strain CH34, plasmid-free strain AE104, etc.) to assess its contribution to metal resistance . Complementation experiments, where the czcN gene is reintroduced on a plasmid vector, can confirm if observed phenotypes are directly attributable to czcN. Expression of recombinant CzcN in heterologous hosts like E. coli can assess its independent contribution to metal resistance, similar to studies of zntA and cadA . Additionally, creating reporter gene fusions (czcN-lacZ) would provide insights into expression patterns in response to different metals and in various genetic backgrounds.

What approaches can be used to study CzcN protein interactions with other Czc components?

Understanding protein-protein interactions is essential for elucidating CzcN's role:

ApproachApplicationExpected Outcome
Bacterial two-hybridDirect interaction screeningIdentifies binary interactions between CzcN and other Czc proteins
Co-immunoprecipitationIn vivo interaction validationConfirms physiologically relevant interactions in R. metallidurans
Pull-down assaysBinding partner identificationDetects stable interactions with purified recombinant CzcN
Cross-linking studiesTransient interaction captureReveals dynamic interactions during metal stress response
FRET/BRETReal-time interaction monitoringVisualizes interactions in living cells under different conditions
Structural studiesInteraction interface mappingDetermines atomic details of CzcN-partner complexes

These complementary techniques would provide insights into whether CzcN interacts with the CzcCBA efflux system, regulatory proteins like CzcI/CzcI₂, or other components of the metal resistance network.

How does the Czc system prevent "overexcretion" of essential metals?

The Czc system exhibits a sophisticated regulatory mechanism to prevent "overexcretion" of essential metals like zinc, which could paradoxically lead to metal starvation. The search results indicate that "CzcI proteins may decrease activity of the CzcCBA transenvelope efflux system, possibly to diminish excessive export of the essential periplasmic transition metals Co and Zn, which might lead to metal starvation" . This finding reveals an elegant negative feedback loop that prevents the protective efflux system from becoming too efficient at removing metals. Understanding whether CzcN participates in this regulatory balance would be crucial for a complete model of the system. Researchers could investigate whether CzcN interacts with CzcI proteins or directly modulates CzcCBA activity, perhaps serving as another control point to prevent overexcretion of essential metals during detoxification responses.

How does the Czc system in R. metallidurans compare to metal resistance systems in other bacteria?

The Czc system in R. metallidurans represents one of the most sophisticated and effective metal resistance mechanisms known in bacteria. Comparative analysis reveals that R. metallidurans "contains more efflux pumps than most other sequenced bacteria" , making it "better able to withstand high concentrations of heavy metals than any other well-studied organism" . The multi-layered defense strategy involving plasmid-borne CzcCBA efflux systems working in concert with chromosomal P-type ATPases may represent an evolutionary adaptation to extremely metal-rich environments. When studying CzcN, researchers should consider comparative analyses with functionally equivalent proteins in other metal-resistant bacteria to understand whether its role is unique to R. metallidurans or represents a conserved mechanism in bacterial metal homeostasis.

What is the evolutionary history of the czc genes in Ralstonia species?

The czc determinants show an interesting evolutionary history reflected in their genomic organization. The core czcCBA genes are located on plasmid pMOL30, suggesting potential acquisition through horizontal gene transfer . Related components are distributed across different genetic elements: some on plasmids (pMOL28, pMOL30), some on the main chromosome, and others on the chromid . This distribution reflects the complex evolutionary history of the system, possibly involving multiple gene duplication and horizontal transfer events. For example, there are multiple paralogs of czcI (plasmid-encoded CzcI and chromid-borne CzcI₂) , suggesting evolutionary diversification. When studying CzcN, researchers should consider its genomic context and relationship to other czc genes to understand its evolutionary origins and the selective pressures that shaped its function.

How does the taxonomic reclassification of R. metallidurans affect research on the Czc system?

The bacterial strain harboring the Czc system has undergone multiple taxonomic reclassifications over the years: "Alcaligenes eutrophus, then Ralstonia sp., Ralstonia eutropha or R. eutropha-like and finally Ralstonia metallidurans" , with the current accepted name being Cupriavidus metallidurans. This taxonomic evolution creates challenges for researchers, as literature spanning decades may use different names for the same organism. When conducting literature searches on CzcN, researchers must use all historical taxonomic designations to ensure comprehensive coverage. Additionally, strain designations are critical: strain CH34 is the reference strain originally isolated "in the late 1970s in sediments of a decantation basin of a zinc factory in Belgium" , while derived strains like AE104 (plasmid-free) and AE128 (containing only pMOL30) are commonly used experimental models . Understanding this taxonomic history is essential for contextualizing research on the Czc system and its components.

What expression systems are optimal for producing recombinant CzcN protein?

Based on successful approaches with other components of the Czc system, several expression strategies should be considered for recombinant CzcN production:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, simple handlingPotential toxicity due to metal-binding properties
Native R. metalliduransProper folding, authentic modificationsLower yield, more complex handling
Heterologous bacterial hostsIntermediate yields, potential for functional studiesMay require optimization for each host
Cell-free systemsAvoids toxicity issuesHigher cost, potentially lower activity

The choice depends on research goals: structural studies may require high yields from E. coli systems with affinity tags for purification, while functional studies might benefit from expression in metal-sensitive bacteria to assess complementation. Researchers should consider fusion tags that facilitate purification without interfering with metal-binding properties, and expression conditions that mitigate potential toxicity issues.

What purification challenges are associated with recombinant CzcN protein?

Purification of recombinant CzcN likely presents specific challenges related to its metal-binding properties and potential membrane association. Based on studies of related proteins, researchers should anticipate:

  • Metal contamination during purification that could affect protein stability and function

  • Potential aggregation or precipitation in the absence of appropriate metal ions

  • Challenges with solubility if CzcN contains membrane-associated domains

  • Maintaining native conformation throughout purification

Strategies to address these challenges include using metal-free buffers during initial purification steps, followed by controlled metal reconstitution; employing gentle detergents if membrane association is present; and utilizing size exclusion chromatography to ensure monodispersity. Verification of purified CzcN activity would require developing specific assays related to its function, potentially involving metal binding or protein-protein interaction studies.

How can the functional activity of purified recombinant CzcN be assessed?

Developing appropriate functional assays for recombinant CzcN is essential for verifying its biological activity:

Assay TypeMethodologyInformation Obtained
Metal bindingITC, fluorescence quenching, equilibrium dialysisBinding affinities for different metals
Protein interactionSPR, MST, co-IP with other Czc componentsIdentification of binding partners
ComplementationExpression in czc-deficient strainsIn vivo functional restoration
Structural changesCD spectroscopy with/without metalsMetal-induced conformational changes
ATPase activityIf CzcN exhibits such activityEnzymatic function quantification

The choice of assays should be guided by hypotheses about CzcN's function within the Czc system. If it's primarily a regulatory protein, interaction studies with CzcCBA components or regulatory proteins like CzcI would be most informative. If it functions in metal sensing, direct metal binding assays would be critical. A combination of in vitro biochemical approaches and in vivo functional studies would provide the most comprehensive assessment of recombinant CzcN activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.