Recombinant Ralstonia metallidurans Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Heavy Metal Resistance

R. metallidurans is renowned for surviving metal-rich environments (e.g., Zn, Cd, Pb) via efflux pumps and ATPases . PlsY’s role in membrane lipid biosynthesis may indirectly support membrane stability under metal stress, though direct evidence is pending.

Metabolic Engineering

PlsY’s ability to initiate phospholipid synthesis makes it a candidate for engineering lipid pathways in:

  • Biofuel Production: Modifying acyl chain composition in glycerolipids .

  • Heterologous Expression Systems: R. metallidurans has been used to express environmental DNA for novel metabolite discovery, highlighting its utility as a host for recombinant enzymes .

Research Limitations and Future Directions

  • Functional Studies: Most mechanistic data derive from PlsY homologs (e.g., S. pneumoniae) . Direct biochemical assays on R. metallidurans PlsY are needed.

  • Industrial Scalability: Stability issues (e.g., sensitivity to repeated freeze-thaw cycles) require optimization for large-scale use .

Comparative Analysis with Homologs

FeatureR. metallidurans PlsYS. pneumoniae PlsY
HostGram-negative, metal-resistantGram-positive pathogen
Catalytic MotifsConserved cytoplasmic domainsSimilar motifs (validated)
InhibitorsPalmitoyl-CoA (noncompetitive)Palmitoyl-CoA

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
plsY; Rmet_0517; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
plsY
Target Protein Sequence
MINLLFAVIAYLIGSVSFAVVVSKVMGLPDPHSYGSGNPGATNVLRTGNKKAAIFTLIGD ALKGLAAVLLAKHFGPAYGVDETGIALVALAVFLGHLFPLYHRFAGGKGVATAAGILFAI DPILGAGTLATWLIIAFFFRYSSLAALISAIFAPFFYVLMNGVDIMAGAILVISVLLIAR HRANIAKLLAGKESRIGEKKKV
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ralstonia metallidurans and why is it significant for plsY research?

Ralstonia metallidurans (formerly known as Alcaligenes eutrophus and later as Ralstonia eutropha) is a β-Proteobacterium that specifically colonizes industrial sediments, soils, or wastes with high heavy metal content. Its significance stems from its remarkable adaptability to toxic environments through specialized resistance mechanisms . The strain CH34 carries two large plasmids (pMOL28 and pMOL30) containing various genes for metal resistance, making it a model organism for studying bacterial adaptation to extreme conditions . This adaptation capability extends to its metabolic pathways, including lipid metabolism enzymes like Glycerol-3-phosphate acyltransferase (plsY), which may have evolved unique properties to function optimally in metal-contaminated environments.

What is the biological function of Glycerol-3-phosphate acyltransferase (plsY) in bacterial systems?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the first and rate-limiting step in phospholipid biosynthesis, specifically the acylation of glycerol-3-phosphate to form lysophosphatidic acid . This enzyme plays a crucial role in membrane lipid composition and cellular envelope integrity. In detailed studies of glycerol-3-phosphate acylation in other systems, researchers have observed that this enzyme incorporates different fatty acyl moieties (such as palmitoyl and oleoyl residues) into phosphatidic acid . When presented with an equimolar mixture of palmitoyl-CoA and oleoyl-CoA, the enzyme shows a preference for incorporating unsaturated fatty acyl moieties, resulting in predominantly monoenoic species in the phosphatidic acid product . This selective incorporation significantly influences membrane fluidity and function.

How does the genetic context of plsY in R. metallidurans compare to other bacterial species?

While the specific genetic context of plsY in R. metallidurans is not directly detailed in current literature, comparative genomic analyses with related species provide valuable insights. R. metallidurans has a complex genome including a chromosome and large plasmids that contain numerous specialized genes . Like other bacterial species, the plsY gene in R. metallidurans would be expected to be chromosomally encoded, potentially as part of a lipid biosynthesis operon. The genomic sequencing of R. metallidurans has revealed numerous mobile genetic elements and genomic islands that contain genes acquired through horizontal gene transfer . This suggests that even metabolic genes like plsY may have unique evolutionary histories in this organism compared to other bacterial species, potentially contributing to its extraordinary adaptability.

What are the optimal expression systems for producing recombinant R. metallidurans plsY protein?

Based on established protocols for similar recombinant proteins from R. metallidurans, E. coli expression systems represent the primary choice for plsY production . For laboratory-scale expression, pET-based vectors with T7 promoters in E. coli BL21(DE3) or its derivatives often yield satisfactory results. The expression construct should include:

  • A strong inducible promoter (T7 or similar)

  • An appropriate affinity tag (6xHis, GST, or MBP) to facilitate purification

  • Optional solubility-enhancing fusion partners if expression yields insoluble protein

When designing the expression construct, researchers should consider:

  • Codon optimization based on E. coli codon usage

  • Inclusion of protease cleavage sites for tag removal

  • Temperature modulation during induction (typically 16-25°C for membrane-associated proteins like plsY)

  • Addition of mild detergents in lysis buffers to maintain solubility

Alternative expression systems including cell-free protein synthesis may be considered for membrane proteins that prove challenging to express in standard systems.

What methodological approaches can be used to assess the metal tolerance effects on plsY activity in R. metallidurans?

Given R. metallidurans' exceptional metal resistance properties , investigating how various metals affect plsY activity requires sophisticated experimental designs:

  • In vitro enzyme assays: Purified recombinant plsY can be assessed for activity in the presence of varying concentrations of metal ions (Cu²⁺, Zn²⁺, Cd²⁺, etc.) using radioisotope-labeled or fluorescent substrates to measure acyltransferase activity.

  • Metal exposure studies: Cultured R. metallidurans cells can be exposed to different metal concentrations, followed by quantitative RT-PCR and proteomic analysis to measure changes in plsY expression.

  • Structural studies with metals: X-ray crystallography or NMR studies of plsY in the presence of various metals can reveal potential binding sites and conformational changes.

  • Comparative activity profiles: The following table represents a typical experimental design for comparing plsY activity under different metal exposure conditions:

Metal IonConcentration Range (μM)Relative plsY Activity (%)Membrane Lipid Composition Changes
Control0100Baseline phospholipid profile
Cu²⁺10-500Experimental valueChanges in unsaturated/saturated ratio
Zn²⁺10-500Experimental valueChanges in acyl chain length
Cd²⁺5-250Experimental valueChanges in head group distribution
  • Adaptive response studies: Long-term culturing of R. metallidurans in metal-enriched media followed by analysis of evolved changes in plsY sequence, expression, and activity.

How can researchers effectively characterize substrate specificity of recombinant R. metallidurans plsY?

Characterizing the substrate specificity of plsY requires multiple complementary approaches:

  • Acyl-CoA competition assays: Similar to studies with microsomes , providing the enzyme with mixtures of different acyl-CoA donors (varying in chain length and saturation) can reveal preferences. HPLC or mass spectrometry analysis of reaction products provides quantitative data on incorporation rates.

  • Kinetic parameter determination: Measuring Km and Vmax values for different substrates using steady-state kinetics approaches.

  • Site-directed mutagenesis: Altering putative substrate-binding residues to assess their contribution to specificity.

  • Structural biology approaches: X-ray crystallography or cryo-EM studies with substrate analogs can reveal binding pocket architecture.

  • Computational docking studies: In silico modeling of different substrates in the active site when structural data becomes available.

Based on previous studies of glycerol-3-phosphate acyltransferases, researchers should pay particular attention to the preference for unsaturated versus saturated acyl chains, as this has been shown to significantly impact product formation in related systems .

What purification strategies are most effective for obtaining active recombinant R. metallidurans plsY?

Purification of membrane-associated enzymes like plsY presents specific challenges that can be addressed through a strategic approach:

  • Initial solubilization: Choose mild detergents for membrane protein extraction, such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at concentrations just above their critical micelle concentration.

  • Affinity chromatography: Utilize the affinity tag incorporated in the expression construct (typically His-tag) for initial capture under detergent-containing conditions.

  • Secondary purification: Apply size exclusion chromatography or ion exchange chromatography to achieve higher purity.

  • Detergent exchange: Consider replacing the initial solubilizing detergent with a more suitable one for subsequent activity assays or crystallization attempts.

  • Stability assessment: Monitor protein stability using thermal shift assays to identify optimal buffer conditions that maintain enzyme activity.

Typical purification yields for recombinant proteins from R. metallidurans in E. coli systems range from 2-5 mg per liter of culture , though membrane proteins like plsY may yield less due to expression challenges.

What are the critical factors in designing activity assays for R. metallidurans plsY?

Developing robust activity assays for plsY requires careful consideration of multiple factors:

  • Substrate preparation: Ensure the quality and purity of glycerol-3-phosphate and acyl-CoA substrates. Acyl-CoA donors are particularly prone to hydrolysis and should be freshly prepared or stored properly.

  • Detection methods: Consider multiple detection options:

    • Radioisotope-based assays using ¹⁴C-labeled substrates for high sensitivity

    • Coupled enzyme assays that link product formation to spectrophotometric changes

    • Direct detection of CoA release using DTNB (Ellman's reagent)

    • Mass spectrometry for detailed product analysis

  • Reaction conditions optimization:

    • pH optimization (typically pH 7.0-8.0)

    • Temperature range assessment (25-37°C)

    • Metal ion cofactor requirements

    • Detergent type and concentration

  • Control reactions: Include proper controls:

    • Heat-inactivated enzyme

    • Reactions without glycerol-3-phosphate

    • Reactions without acyl-CoA

  • Time course analysis: Ensure measurements are taken in the linear range of the reaction to accurately determine initial velocities.

How can researchers effectively analyze the structure-function relationship of R. metallidurans plsY?

Investigating structure-function relationships requires an integrated approach:

  • Primary sequence analysis: Compare plsY sequences across species to identify conserved domains and potential metal-binding motifs using bioinformatics tools.

  • Homology modeling: In the absence of crystal structures, create homology models based on related proteins with known structures.

  • Site-directed mutagenesis: Target specific residues based on sequence conservation or predicted functional importance:

    • Catalytic triad residues

    • Substrate binding pocket residues

    • Potential metal-coordinating residues

  • Truncation analysis: Create systematic truncations or domain swaps to identify functional regions.

  • Protein-substrate interactions: Use techniques such as SPR (Surface Plasmon Resonance) or ITC (Isothermal Titration Calorimetry) to quantify binding parameters.

  • Structural biology approaches: When possible, pursue X-ray crystallography, cryo-EM, or NMR studies to determine the three-dimensional structure.

A systematic experimental design for structure-function analysis might include:

Mutation/ModificationExpected Functional ImpactExperimental Readout
Active site residuesReduced catalytic activityEnzyme kinetics assays
Substrate binding pocketAltered substrate specificityCompetitive substrate assays
Metal-coordinating residuesChanged metal tolerance profileActivity assays with metal ions
Truncated domainsDomain-specific functional lossTargeted functional assays

How does R. metallidurans plsY compare functionally to homologous enzymes from non-metal-tolerant bacteria?

Comparative analysis of plsY from R. metallidurans versus non-metal-tolerant bacteria can reveal adaptations specific to metal-rich environments:

  • Sequence divergence analysis: Identify unique residues or motifs in R. metallidurans plsY compared to homologs from bacteria like E. coli or B. subtilis.

  • Kinetic parameter comparison: Compare Km, Vmax, and catalytic efficiency across species under standard and metal-stress conditions.

  • Metal inhibition profiles: Determine IC₅₀ values for various metals across different bacterial plsY enzymes to identify differential tolerance.

  • Product profile analysis: Compare the lipid products generated by different plsY enzymes, particularly focusing on the incorporation of saturated versus unsaturated fatty acids .

  • Physiological context consideration: Examine how membrane lipid composition varies across species in response to metal exposure, connecting enzyme function to cellular adaptation.

Expected findings might include enhanced stability of R. metallidurans plsY in the presence of heavy metals, potential metal-binding sites absent in homologs from non-metal-tolerant bacteria, or altered substrate specificity that contributes to membrane adaptations required for metal tolerance.

What insights can proteomics approaches provide about plsY regulation in R. metallidurans?

Proteomic approaches offer powerful tools for understanding plsY regulation in the context of R. metallidurans' complex adaptive responses:

  • Differential proteomics: Compare protein expression profiles between R. metallidurans grown under normal conditions versus metal stress conditions, identifying changes in plsY abundance and potential post-translational modifications .

  • Interactome analysis: Use pull-down assays coupled with mass spectrometry to identify proteins that interact with plsY, potentially revealing regulatory partners.

  • Post-translational modification mapping: Identify phosphorylation, acetylation, or other modifications that might regulate plsY activity under different environmental conditions.

  • Temporal proteomics: Track changes in protein abundance over time following metal exposure to understand the dynamic regulation of lipid metabolism enzymes.

  • Integration with transcriptomics: Combine proteomic data with transcriptomic analysis to create a comprehensive understanding of plsY regulation at both mRNA and protein levels.

Existing proteomic studies with R. metallidurans have successfully identified numerous proteins involved in metal resistance , suggesting similar approaches could reveal regulation mechanisms for metabolic enzymes like plsY.

How might genetic engineering of R. metallidurans plsY contribute to biotechnological applications?

The unique properties of R. metallidurans plsY could be leveraged for various biotechnological applications:

  • Bioremediation enhancement: Engineered strains with modified plsY could potentially create membranes more resistant to metal toxicity, improving survival in contaminated environments during bioremediation projects .

  • Biocatalysis in harsh conditions: If R. metallidurans plsY demonstrates unusual stability or activity in the presence of metals, it could be utilized for industrial biocatalysis in conditions where conventional enzymes fail.

  • Synthetic biology applications: The plsY enzyme could be integrated into synthetic pathways for the production of specialty lipids, particularly if it demonstrates unique substrate specificity.

  • Biosensor development: Coupling plsY activity to reporter systems could create biosensors for monitoring metal contamination in environmental samples.

  • Structure-guided enzyme engineering: Creating plsY variants with enhanced activity or altered specificity through rational design or directed evolution approaches.

The combination of R. metallidurans' metal tolerance mechanisms with metabolic engineering of lipid biosynthesis could create robust biological systems for various industrial applications, particularly in metal-contaminated environments where conventional microorganisms fail to thrive.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.