Recombinant Ralstonia metallidurans Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please specify them in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; Rmet_0757; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-594
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
msbA
Target Protein Sequence
MASGANVTDNKQQTPQESDTLKRVWAYLKPEKRNFVLAIIAMGLVAASEGIIPKVVNDLL DKGFGGSYAGKLWHVPALLVGVALVRGLAQFASGYLLSQISNGVLLKMRMQMFDRMLHAP ALFFHRNTAASLINAVIFEVNQVMQILTGVLITLVRDSLTVVALLIYLFYTNWKLTLVVA VLLPAIGFVMSKVNRRLRRLNREHQALTNTAAYVVEESVGGFKVVKLHGGEAYEMSRFEA MAERLRGYSMRMAVAGGLNQPVTAFLASLALSVILTIAMIQAQGNQTTIGGFTGFVMAML LLISPLKHLADLNQPLQRGLTAAEMIFGLIDEPIEPQNGGLPLERARGDLVFDNVGFRYG DAARAALNHVSLRAAPGEVVALVGPSGSGKTTLVNLVPRFFDPTEGHILLDGQPIDRFAL ADLRRQIAFVSQDVVLFNDTVAANVAYGVHPREKIDMARVERALAAAYLTDVVKGLPEGL ETNIGDNGMKLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERQVQAALESLMVGR TTLVIAHRLSTIENADRIVVLEQGRVAEQGSHAELIGKNGLYAGLHRIQFASQA
Uniprot No.

Target Background

Function
This protein plays a role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what is its function in Ralstonia metallidurans?

MsbA is an essential ATP-binding cassette (ABC) transporter in gram-negative bacteria that transports lipid A and lipopolysaccharide from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . In R. metallidurans, this protein plays a critical role in cell membrane biogenesis and potentially contributes to the bacterium's remarkable ability to survive in environments with high metal content . Functionally characterized as a lipid flippase, MsbA uses transmembrane domains (TMDs) to form a pore in the inner membrane while its ATP-binding domain (NBD) generates the energy required for substrate translocation .

How does R. metallidurans MsbA compare to homologs in other bacteria?

R. metallidurans (recently reclassified as Cupriavidus metallidurans) is a beta-Proteobacterium specifically adapted to colonize industrial sediments, soils, or wastes with high heavy metal content . While the core function of MsbA as a lipid transporter remains consistent across gram-negative bacteria, the R. metallidurans variant likely contains adaptations that integrate with the organism's extensive metal resistance mechanisms. The type strain CH34 carries two large plasmids (pMOL28 and pMOL30) bearing various metal resistance genes , and MsbA may interact with this resistance network. Comparative genomic analysis between R. metallidurans and other bacteria like R. solanacearum has revealed the presence of numerous metal resistance loci on both plasmids and the chromosome .

What methods are recommended for expressing and purifying recombinant MsbA?

When expressing recombinant MsbA, researchers should consider:

Expression systems:

  • Bacterial expression systems with inducible promoters

  • Codon optimization for the expression host

  • Addition of affinity tags (His-tag) for purification

Purification strategies:

  • Use of specialized detergents or facial amphiphiles like FA-3 that maintain protein stability and activity

  • Metal affinity chromatography followed by size exclusion chromatography

  • Buffer optimization to prevent aggregation

Recent high-resolution structural studies of MsbA have successfully employed facial amphiphile FA-3, which yields significantly higher ATPase activity (6-10 μmol ATP/min/mg protein) compared to traditional detergents like DDM and UDM .

How can researchers assess MsbA activity in vitro?

MsbA activity can be evaluated through multiple complementary approaches:

Assay TypeMethodologyParameters MeasuredTypical Values
ATPase ActivityQuantification of inorganic phosphate releaseKm, VmaxKm = 0.31 ± 0.05 mM
Lipid TransportFluorescently-labeled lipidsTransport rateVaries by lipid substrate
Conformational ChangesFRET, EPR spectroscopyDistance changesDependent on labeled residues
Binding AssaysITC, MST, SPRKd valuesSubstrate-specific

When conducting these assays, researchers should maintain consistent experimental conditions as MsbA activity is significantly affected by the membrane environment, detergent choice, and temperature .

What are the best experimental designs for studying MsbA conformational changes during lipid transport?

Studying MsbA conformational dynamics requires sophisticated experimental approaches:

  • X-ray crystallography with substrate co-crystallization: This approach has successfully yielded high-resolution structures (2.8 Å) of MsbA in complex with lipid A . Crystallization success improves when using facial amphiphiles like FA-3 and incorporating lipid A directly during crystallization, suggesting that substrate binding stabilizes specific conformations .

  • Cryo-EM in lipid nanodiscs: This approach allows visualization of MsbA in a near-native lipid environment. Previous studies have achieved 4.7 Å resolution (4.2 Å for TMDs) and revealed LPS trapped within a transmembrane pocket .

  • Single-particle analysis: This technique can capture the continuum of open and closed conformations that MsbA occupies, revealing its substantial conformational flexibility .

  • Comparative structural analysis: By comparing structures in different conformational states (inward-facing vs. outward-facing), researchers can reconstruct the complete transport mechanism. The recent S. typhimurium MsbA structure displays "a large amplitude opening in the transmembrane portal," likely required for lipid A entry .

When designing these experiments, consider that MsbA exists in a dynamic equilibrium between conformational states that are coupled to ATP binding and hydrolysis in the NBDs .

How should researchers address potential selective reporting when studying MsbA function?

To ensure research integrity when studying MsbA, implement these methodological safeguards:

  • Predefine inclusion and exclusion criteria: Establish clear, objective criteria for experimental validity before collecting data . For example, predetermined ATPase activity thresholds for functional protein or specific positive/negative control outcomes.

  • Document all experimental attempts: Report all experiments, including those that "didn't work," to avoid confirmation bias . This is particularly important when testing substrate specificity or inhibitors.

  • Use blind data analysis: Have experts who are blinded to results make inclusion decisions based on methodological criteria rather than outcomes .

  • Transparently report post-hoc decisions: If criteria are adjusted after seeing results, clearly mark these as exploratory rather than confirmatory findings .

  • Implement validation controls: For MsbA specifically, include appropriate positive controls (known substrates) and negative controls (non-functional mutants) .

As noted in the literature, "Agreement with predictions or previous findings should never be criteria for including an experiment in an article" , and "Confirmation bias can easily lead one to discard experiments that 'didn't work' by attributing the results to experimental artifacts" .

What approaches can be used to study the role of MsbA in bacterial metal resistance mechanisms?

Given R. metallidurans' exceptional adaptation to metal-rich environments, exploring MsbA's potential role in metal resistance requires specialized approaches:

  • Comparative proteomics: Compare MsbA expression levels between metal-exposed and control conditions. Recent proteomic analysis of C. metallidurans has revealed response mechanisms to antimicrobial silver nanoparticles that might involve membrane transport systems .

  • Gene knockout/complementation studies: Assess how MsbA mutation affects metal tolerance, though complete knockout may be lethal given MsbA's essential nature.

  • Membrane composition analysis: Determine if MsbA activity influences membrane lipid composition under metal stress conditions.

  • Regulatory network mapping: Identify if metal response regulatory systems like the two-component systems found in other bacteria affect MsbA expression .

  • Biofilm formation studies: Assess whether MsbA function contributes to biofilm resilience against metals, as C. metallidurans biofilms show age-dependent resistance to antimicrobial agents .

R. metallidurans has evolved to be "particularly well adapted to the harsh environments typically created by extreme anthropogenic situations or biotopes" , making it an excellent model for studying membrane transport adaptations to metal stress.

How can researchers validate potentially contradictory findings about MsbA substrate specificity?

Resolving contradictions regarding MsbA substrate specificity requires rigorous experimental design:

  • Multi-laboratory replication: Implement standardized protocols across different research groups to test substrate specificity under identical conditions.

  • Multiple detection methods: Use complementary techniques (fluorescence-based assays, radiolabeled substrates, mass spectrometry) to confirm substrate transport.

  • Competition assays: Determine substrate preferences by measuring transport rates when multiple potential substrates are present simultaneously.

  • Structure-guided mutagenesis: Based on the recent structural data showing putative lipid A binding sites "inside the transmembrane cavity" and "near an outer surface cleft" , create targeted mutations to disrupt specific substrate interactions.

  • Physiological relevance testing: Assess whether in vitro substrate preferences translate to in vivo membrane composition changes using lipidomics.

While MsbA is primarily characterized as a lipid A/LPS transporter, some studies suggest it "may act also as a flippase of glycerophospholipids" . Carefully controlled experiments are needed to determine if this represents a secondary function or an artifact of experimental conditions.

What statistical approaches are most appropriate for analyzing MsbA functional data?

When analyzing MsbA functional data, researchers should implement these statistical best practices:

  • Enzyme kinetics analysis: For ATPase activity, apply Michaelis-Menten kinetics to determine Km and Vmax parameters. Recent studies found a Km value of 0.31 ± 0.05 mM for MsbA in FA-3, comparable to MsbA in nanodiscs .

  • Between-subjects versus within-subjects design: When comparing different MsbA variants or conditions, carefully consider experimental design. Between-subjects designs compare different treatment groups, while within-subjects designs test all conditions on the same sample .

  • Counterbalancing: For within-subjects designs, randomize the order of manipulations to prevent order effects from confounding results .

  • Operationalization of variables: Clearly define how abstract variables will be measured before data collection begins .

  • Preregistration of analysis plans: To prevent p-hacking or other forms of unintentional bias, predefine statistical tests and significance thresholds .

  • Appropriate controls for multiple comparisons: When testing multiple hypotheses (e.g., comparing multiple MsbA mutants), apply statistical corrections like Bonferroni or false discovery rate methods.

How should researchers design experiments to distinguish between MsbA's role in lipid A versus glycerophospholipid transport?

To differentiate MsbA's substrate preferences:

  • Design quantitative transport assays with defined substrates: Create proteoliposome systems with purified MsbA where transport of fluorescently labeled lipid A versus glycerophospholipids can be quantitatively measured.

  • Structure-based mutagenesis: Utilizing the X-ray structure of MsbA from S. typhimurium at 2.8 Å resolution , introduce mutations at putative substrate binding sites to selectively disrupt binding of specific lipid types.

  • Implement trapped intermediate states: Use non-hydrolyzable ATP analogs or Walker B mutations to capture MsbA-substrate complexes for structural or biochemical analysis.

  • Develop competition binding assays: Quantify displacement of bound labeled substrates with various unlabeled lipids to establish relative binding affinities.

  • Correlation with physiological conditions: Test how environmental factors that affect R. metallidurans, such as metal exposure, might alter substrate preference.

Existing structural data revealed "putative lipid A density is observed further inside the transmembrane cavity, consistent with a trap and flip model. Additional electron density attributed to lipid A is observed near an outer surface cleft at the periplasmic ends of the transmembrane helices" . These observations provide a foundation for designing targeted experiments.

What validation criteria should be established for MsbA functional studies?

Based on principles for addressing selective reporting in experiments , researchers should establish these predefined validation criteria:

  • Protein quality thresholds:

    • Purity >95% by SDS-PAGE

    • A260/A280 ratio <0.6 (indicating minimal nucleic acid contamination)

    • Monodispersity by dynamic light scattering

    • Baseline ATPase activity within 20% of reference standards

  • Control experiment outcomes:

    • Positive controls (known substrates) show >50% transport efficiency

    • Negative controls (ATP-binding site mutants) show <10% of wild-type activity

    • Temperature controls demonstrate expected thermostability profile

  • Replication requirements:

    • Minimum of three biological replicates (different protein preparations)

    • Technical replicates showing coefficient of variation <15%

    • Consistent results across multiple experimental approaches

  • Data quality metrics:

    • Signal-to-noise ratio >5:1 for transport assays

    • Statistically significant differences (p<0.05) from negative controls

    • Dose-response relationships follow expected models

As emphasized in the literature, these criteria must be established "without seeing the results, in order to counter the possibility of bias" and should be documented in experimental protocols before data collection begins.

What are common challenges in MsbA research and how can they be addressed?

ChallengePotential CausesTroubleshooting Approaches
Low protein yieldToxicity to expression host, improper inductionOptimize expression conditions, use specialized bacterial strains, consider cell-free systems
Loss of activity during purificationDetergent-induced destabilizationTest facial amphiphiles like FA-3 which maintain higher activity (6-10 μmol ATP/min/mg protein)
Poor crystallizationConformational heterogeneityCo-crystallize with substrates and stabilizing ligands; MsbA crystals diffracted better when lipid A was incorporated
Inconsistent activity measurementsBatch-to-batch variationStandardize buffer conditions, use internal controls, normalize to positive control samples
Difficulties capturing transient statesRapid conformational changesEmploy conformation-specific stabilizers, conduct time-resolved studies
Distinguishing direct vs. indirect effectsComplex biological systemsUse reconstituted systems with defined components, create targeted mutations

For R. metallidurans MsbA specifically, researchers should also consider the complex interplay between metal resistance mechanisms and membrane transport functions that make this organism uniquely adapted to harsh environments .

How can researchers optimize experimental design when studying MsbA from R. metallidurans?

When designing experiments with R. metallidurans MsbA:

  • Consider environmental context: R. metallidurans thrives in metal-rich environments and forms resilient biofilms . Design experiments that account for these biological adaptations.

  • Implement quantitative research approaches: Frame research questions to quantify variables and analyze relationships between them . For example, measure how varying metal concentrations affect MsbA expression or activity.

  • Balance between-subjects and within-subjects designs: For comparing different conditions (e.g., metal exposures), carefully select appropriate experimental designs based on the specific hypothesis being tested .

  • Incorporate appropriate controls: Include both positive controls (known MsbA substrates) and negative controls (non-functional mutants or unrelated membrane proteins).

  • Operationalize abstract variables: Define precisely how concepts like "metal resistance" or "transport activity" will be measured before data collection .

By following these methodological principles, researchers can maximize the reliability and reproducibility of their findings about this important bacterial transporter.

What are the most promising research directions for understanding MsbA function in R. metallidurans?

  • Integration with metal resistance pathways: Investigate potential functional relationships between MsbA activity and the extensive metal resistance mechanisms in R. metallidurans, which contains numerous resistance loci on both plasmids (pMOL28 and pMOL30) and the chromosome .

  • Role in biofilm formation and resilience: Explore how MsbA functions in the context of biofilm development, as C. metallidurans biofilms show age-dependent resistance to antimicrobial agents like silver nanoparticles .

  • Comparative studies across bacterial species: Build on previous work comparing MsbA from different bacteria to understand evolutionary adaptations in this essential transporter, particularly in extremophiles like R. metallidurans .

  • Potential as an antimicrobial target: Because of its critical role in LPS trafficking and outer membrane assembly, MsbA represents "a viable target for new antibiotics" . Research could focus on developing specific inhibitors against R. metallidurans MsbA.

  • Applications in bioremediation: Given R. metallidurans' remarkable metal resistance properties, understanding how MsbA contributes to this adaptation could inform biotechnological applications for environmental cleanup of contaminated sites.

By pursuing these research directions with rigorous experimental designs and robust statistical approaches, researchers can advance our understanding of this fascinating bacterial transporter and its role in environmental adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.