Recombinant Ralstonia metallidurans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant nuoK is manufactured under optimized conditions to ensure high yield and stability:

ParameterSpecification
Expression HostE. coli
Tag TypeN-terminal His-tag
Purity>85% (SDS-PAGE validated)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C (long-term); 4°C for short-term aliquots

Repeated freeze-thaw cycles are discouraged to preserve structural integrity .

Functional Role in the NDH-1 Complex

nuoK interacts with other NDH-1 subunits (e.g., nuoA, nuoB, nuoH–nuoN) to form a multi-protein complex. Key functions include:

  • Electron transfer: Mediates redox reactions via FMN and iron-sulfur centers .

  • Proton translocation: Couples NADH oxidation to H⁺ efflux, generating a proton motive force .

The subunit’s transmembrane topology facilitates interaction with the lipid bilayer, ensuring proper assembly of the complex .

Research Applications

Recombinant nuoK is employed in diverse experimental contexts:

ApplicationDescription
ELISA DevelopmentUsed as an antigen in enzyme-linked immunosorbent assays for antibody detection .
Structural StudiesHis-tagged nuoK enables crystallization for X-ray diffraction or NMR studies .
Protein Interaction MappingIdentifies binding partners in the NDH-1 complex using pull-down assays .

ELISA kits incorporating nuoK are priced at ~$1,442 for 50 µg, reflecting its niche utility in specialized immunological research .

Comparative Analysis with Related Subunits

While nuoK is distinct from Na⁺-translocating NADH:quinone oxidoreductase (Na⁺-NQR) subunits, structural parallels exist:

SubunitFunctionSource
nuoKH⁺ translocation, electron transferRalstonia metallidurans
NqrMMaturation of Na⁺-NQR (Fe delivery)Vibrio harveyi

nuoK’s role contrasts with NqrM, which is essential for flavin cofactor attachment in Na⁺-NQR .

Challenges and Future Directions

  • Low Yield: Full-length nuoK is challenging to produce due to hydrophobic transmembrane regions .

  • Oxidative Stress Sensitivity: Requires stringent redox conditions during purification .

  • Cryo-EM Applications: Emerging techniques may resolve nuoK’s membrane topology in NDH-1 complexes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Rmet_0937; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
nuoK
Target Protein Sequence
MLSLAHFLVLGAILFAISIVGIFLNRKNVIVLLMALELLLLAVNMNFVAFSHYMGDLAGQ VFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDMDTLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ralstonia metallidurans NADH-quinone oxidoreductase subunit K?

NADH-quinone oxidoreductase subunit K (nuoK) is an integral membrane protein component of the respiratory complex I (NADH dehydrogenase I) in Ralstonia metallidurans. This protein is encoded by the nuoK gene (locus name Rmet_0937) in the R. metallidurans genome . The complete amino acid sequence of nuoK consists of 101 amino acids: mLSLAHFLVLGAILFAISIVGIFLNRKNVIVLLMALELLLLAVNMNFVAFSHYMGDLAGQVFVFFILTVAAAAESAIGLAILVVLFRNLDTINVDDMDTLKG . As part of the NADH dehydrogenase complex, nuoK plays a critical role in the electron transport chain and energy production processes of the bacterium, potentially contributing to its remarkable ability to survive in metal-contaminated environments.

Why is Ralstonia metallidurans significant in research?

R. metallidurans is a β-Proteobacterium that has evolved exceptional adaptive capabilities to colonize industrial sediments, soils, and wastes with high heavy metal content . The type strain CH34 carries two large plasmids (pMOL28 and pMOL30) containing numerous genes for metal resistance . This bacterium can withstand higher concentrations of heavy metals than most other well-studied organisms, making it an ideal model system for understanding metal resistance mechanisms and a potential agent for bioremediation applications . Genomic analysis reveals that approximately 13% of all genes in R. metallidurans encode transport proteins, with nearly one-third functioning in inorganic ion transport, primarily for cations . This extensive genetic toolkit for metal handling makes R. metallidurans particularly valuable for studying bacterial adaptation to extreme anthropogenic environments.

How does nuoK function within the respiratory chain?

The nuoK protein functions as a subunit of Complex I (NADH:quinone oxidoreductase, EC 1.6.99.5) in the respiratory electron transport chain . As an integral membrane component, nuoK likely participates in proton translocation across the membrane, contributing to the generation of the proton motive force used for ATP synthesis. The highly hydrophobic nature of the protein, evidenced by its amino acid sequence rich in leucine, alanine, and other nonpolar residues, supports its role as a membrane-embedded component . Within the context of R. metallidurans' remarkable heavy metal resistance, nuoK may play a specialized role in maintaining energy metabolism under conditions where toxic metals might otherwise disrupt respiratory processes. The protein's structure likely features multiple transmembrane helices that position it appropriately within the lipid bilayer to facilitate electron transport while potentially protecting the complex from metal-induced damage.

How does the evolution of nuoK in R. metallidurans compare to related species?

The evolutionary path of nuoK in R. metallidurans likely reflects the bacterium's adaptation to metal-rich environments. Comparative analysis with the related plant pathogen Ralstonia solanacearum reveals interesting parallels, as R. solanacearum harbors a megaplasmid (2.1 Mb) containing some metal resistance genes similar to those in R. metallidurans CH34 . Evolutionary analysis of nuoK across these species could reveal selection pressures acting on respiratory components in different ecological niches. The question of whether nuoK in R. metallidurans has undergone adaptive evolution specifically related to metal resistance represents an important research direction. Such comparative studies might identify amino acid substitutions unique to R. metallidurans that confer advantages in metal-rich habitats, further illuminating how this bacterium has become "specifically adapted to toxic metals" as indicated by multiple sources .

What interactions might exist between nuoK and metal resistance determinants?

The comprehensive metal resistance system in R. metallidurans involves genes located on both plasmids and the chromosome . Understanding potential interactions between respiratory components like nuoK and dedicated metal resistance determinants represents an advanced research question. Protein-protein interaction studies, co-expression analyses, and investigations of regulatory networks could reveal whether nuoK functions independently of metal handling systems or participates in coordinated responses. The bacterium's ability to adapt to "harsh environments typically created by extreme anthropogenic situations" suggests highly integrated cellular responses to metal stress. Research examining whether mutations in nuoK affect the expression or function of metal resistance determinants would provide valuable insights into these potential interactions.

What are the optimal conditions for storing and handling recombinant nuoK protein?

Based on the product information, recombinant nuoK requires specific storage conditions to maintain stability and activity. The protein should be stored at -20°C, with -80°C recommended for extended storage periods . Repeated freezing and thawing should be avoided, as this can lead to protein denaturation and loss of structural integrity. For active experiments, working aliquots can be maintained at 4°C for up to one week . The storage buffer typically consists of a Tris-based buffer with 50% glycerol, optimized specifically for this protein . Researchers should consider the highly hydrophobic nature of nuoK when designing experiments, as membrane proteins often require special handling to prevent aggregation. Detergent screening may be necessary to identify optimal conditions for maintaining the protein in solution while preserving its native structure and function.

How can researchers effectively express and purify recombinant nuoK?

Expression and purification of membrane proteins like nuoK present significant challenges. Based on available information, successful expression systems for recombinant nuoK production likely involve E. coli or similar bacterial hosts . The expression region encompasses amino acids 1-101, representing the full-length protein . When designing expression constructs, researchers should consider incorporating affinity tags to facilitate purification, though the specific tag type may need to be determined during the production process to avoid interference with protein folding or function .

For purification, a multi-step approach is typically necessary:

  • Cell lysis under conditions that preserve membrane protein structure

  • Membrane fraction isolation via differential centrifugation

  • Detergent solubilization optimization

  • Affinity chromatography utilizing the incorporated tag

  • Size exclusion chromatography for final purification

This protocol must be optimized specifically for nuoK, as each membrane protein has unique requirements for successful purification in an active form.

What techniques are appropriate for studying nuoK structure-function relationships?

Studying the structure-function relationships of membrane proteins like nuoK requires specialized techniques. Researchers might consider:

  • Site-directed mutagenesis to modify specific amino acids in the hydrophobic regions or potential metal-interacting sites

  • Reconstitution into liposomes or nanodiscs for functional assays

  • Activity assays measuring electron transport efficiency under varying metal concentrations

  • Structural analysis through X-ray crystallography (challenging for membrane proteins) or cryo-electron microscopy

  • Molecular dynamics simulations to predict conformational changes under different conditions

For studying the role of nuoK in metal resistance specifically, researchers could employ complementation studies in nuoK-knockout strains exposed to various metals, measuring growth rates, metal uptake/efflux, and respiratory activity. Protein-protein interaction studies using techniques like bacterial two-hybrid systems or co-immunoprecipitation could identify partners that connect nuoK to metal resistance mechanisms.

How should researchers interpret changes in nuoK expression under metal stress?

When analyzing nuoK expression data from metal exposure experiments, researchers should consider several factors. First, distinguish between direct and indirect effects - changes in nuoK expression might reflect specific responses to metals or general stress responses. Analysis should incorporate time-course studies to capture both immediate and adaptive responses. Researchers should normalize expression data appropriately, considering that reference genes may also be affected by metal stress. Statistical approaches should include multivariate analysis to account for interactions between different metals and physiological parameters.

The table below presents a hypothetical framework for analyzing nuoK expression changes:

Metal TypeConcentration RangeImmediate Response (0-2h)Adaptive Response (24-48h)Correlation with Respiratory ActivityStatistical Significance
Cd2+0.1-5 mMDownregulationUpregulationStrong positivep < 0.01
Cu2+0.5-10 mMNo changeModerate upregulationWeak positivep < 0.05
Zn2+1-20 mMSlight upregulationStrong upregulationStrong positivep < 0.01

This type of comprehensive analysis helps differentiate between specific metal responses and general patterns, informing models of how nuoK contributes to metal resistance mechanisms.

What bioinformatic approaches are most useful for studying nuoK evolution?

Bioinformatic analysis of nuoK evolution requires multiple complementary approaches. Sequence alignment tools (MUSCLE, CLUSTAL) can identify conserved residues across species, while phylogenetic analysis (Maximum Likelihood, Bayesian methods) can reconstruct evolutionary relationships. Selection analysis using PAML or similar tools can detect signatures of positive selection, potentially identifying adaptive changes specific to metal-resistant strains. Protein structure prediction (AlphaFold, Rosetta) can model the impact of sequence variations on protein folding and function.

A comprehensive bioinformatic workflow might include:

  • Collection of nuoK homologs from diverse bacterial species, particularly those from metal-contaminated environments

  • Multiple sequence alignment and conservation analysis

  • Phylogenetic tree construction, mapped against habitat information

  • Selection analysis to identify positions under positive selection in metal-resistant lineages

  • Structural modeling to predict functional consequences of adaptive mutations

  • Comparative analysis with other respiratory complex subunits to identify co-evolutionary patterns

This integrated approach enables researchers to connect sequence evolution to functional adaptations in metal-rich environments.

How can contradictory findings about nuoK function be reconciled?

Scientific literature often contains seemingly contradictory findings about protein function, particularly for complex systems like respiratory chains in extremophiles. When confronting contradictory data about nuoK function, researchers should systematically evaluate:

  • Experimental conditions: Variations in metal types, concentrations, exposure times, and growth media can dramatically affect results

  • Strain differences: Genetic variations between R. metallidurans strains may cause functional differences

  • Methodological approaches: Different techniques (in vivo vs. in vitro, genetic vs. biochemical) may reveal different aspects of function

  • Interaction effects: nuoK function may depend on interactions with other proteins or cellular components

  • Statistical robustness: Sample sizes, replication, and statistical methods affect reliability

Reconciliation often requires meta-analysis approaches, combining data from multiple studies while accounting for methodological differences. Researchers might design experiments specifically to test competing hypotheses under standardized conditions, potentially revealing context-dependent functions that explain apparent contradictions.

What are promising research applications for recombinant nuoK?

Recombinant nuoK has several promising research applications that extend beyond basic characterization. The protein could serve as a model system for studying how respiratory complexes adapt to extreme environments, providing insights into evolution of stress tolerance. Biotechnological applications might include development of biosensors for metal detection, with nuoK-based systems potentially offering specificity for certain metal types. Additionally, understanding nuoK's role in metal resistance could inform bioengineering approaches to enhance bioremediation capabilities of various bacterial species.

Research into nuoK may also advance our understanding of mitochondrial diseases in humans, as respiratory complex I dysfunction underlies numerous pathologies. The bacterial system offers a simpler model for studying fundamental aspects of electron transport that may translate to eukaryotic systems. Furthermore, nuoK structural studies could inform drug development targeting bacterial respiratory chains, potentially yielding new antibiotics that selectively inhibit bacterial energy metabolism.

How might systems biology approaches enhance understanding of nuoK?

Systems biology approaches offer powerful tools for integrating nuoK function into broader cellular contexts. Multi-omics studies combining transcriptomics, proteomics, and metabolomics can reveal how nuoK expression correlates with global cellular responses to metal stress. Network analysis can identify regulatory relationships between nuoK and other genes, potentially uncovering master regulators that coordinate respiratory adaptation with metal resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.