Recombinant Ralstonia metallidurans Nickel and cobalt resistance protein CnrB (cnrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cnrB; Rmet_6209; RMe0084; Nickel and cobalt resistance protein CnrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
cnrB
Target Protein Sequence
MMKNERRSVNWPMIAGVAAVAAAVGFGAAHLPVSEKSPASTQAPEAQKPQSAPVKPGLKE VKIPATYLAAANIAVEPVASAAVGTEILAPATVAALPGSEAVIVSRAAGAVQRVQRRLGD VVKAGDVLALVDSPEAAGMAAERKVAQAKADLARKTYEREASLFQQGVTPRQEMEAAKAA LDVAQAEALRAATVAQSAHLASDGRSVAVVSPIAGKITAQSVTLGAFVAPQAELFRVAGT GAVQVEAAVTAADTSRIVAGSEATILLANGSPLSARVQAVTPTVTGSARVATVVVVPAQP TDRLVVGEGVQVRLRTAVADAAALSVPEDAVQNLDGRDVLFVRTQEGFRPMPVLVGTRSG GSAQILSGVQAGEQVATRNAFLVKAEMNKGGGDEE
Uniprot No.

Target Background

Function
The cnrA, cnrB, and cnrC gene products likely form a membrane-bound protein complex that catalyzes energy-dependent efflux of Ni2+ and Co2+. The CnrCBA complex's mechanism of action may involve proton/cation antiport.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Ralstonia metallidurans and why is it significant in heavy metal resistance studies?

Ralstonia metallidurans (formerly known as Alcaligenes eutrophus and Ralstonia eutropha) is a beta-Proteobacterium that has evolved to colonize industrial sediments, soils, and waste environments with exceptionally high heavy metal content . The type strain CH34 has become particularly significant in resistance studies because it carries two large plasmids (pMOL28 and pMOL30) that harbor a variety of genes encoding metal resistance mechanisms . This bacterium's genomic adaptations make it an excellent model organism for understanding how prokaryotes can survive in environments with toxic metal concentrations. Through evolutionary processes, Ralstonia metallidurans has developed specialized mechanisms that allow it to thrive in harsh environments created by extreme anthropogenic conditions .

What is the CnrB protein and what role does it play in the CnrCBA efflux system?

CnrB is a critical component of the CnrCBA efflux system, which represents one of the primary mechanisms conferring resistance to cobalt and nickel in Ralstonia metallidurans . As part of this three-component resistance-nodulation-cell division (RND) system, CnrB functions as a membrane fusion protein that bridges the inner membrane transporter (CnrA) and the outer membrane protein (CnrC) . Together, these components form a continuous channel across both membranes that actively pumps toxic nickel and cobalt ions out of the bacterial cell. The CnrB protein specifically facilitates the transfer of metal ions from CnrA to CnrC, ensuring efficient extrusion of these toxic metals from the cytoplasm to the extracellular environment, thereby maintaining cellular homeostasis under high metal stress conditions.

What are the functional relationships between CnrB and other metal resistance systems in R. metallidurans?

The CnrB protein and the CnrCBA system share extensive homologies with other metal resistance determinants in R. metallidurans, particularly the CzcCBA system that confers resistance to cobalt, zinc, and cadmium . Research indicates that both the cnr and czc systems likely evolved from a common ancestral operon, explaining their overlapping substrate specificities, particularly for cobalt . This evolutionary relationship is evidenced by the ability of the cnr operon to mutate and acquire additional zinc resistance capabilities . Within the complex network of metal resistance in R. metallidurans, these systems do not function in isolation but rather form part of an integrated response to metal toxicity. Experimental evidence suggests that while the primary function of CnrB is in nickel and cobalt resistance, there may be functional overlap and complementation between different efflux systems, allowing for adaptability to various metal stresses. Researchers investigating CnrB should consider these interrelationships when designing experiments, as disruption of one system may have compensatory effects through the upregulation of homologous systems.

What expression systems are most effective for recombinant production of functional CnrB protein?

When producing recombinant CnrB protein for structural or functional studies, several expression systems have demonstrated varying degrees of effectiveness. E. coli-based expression systems utilizing the pET vector series with T7 promoters have shown success in producing soluble CnrB, particularly when the protein is expressed without its membrane-spanning domains. To enhance solubility, fusion tags such as maltose-binding protein (MBP) or glutathione S-transferase (GST) are often employed. The expression conditions require careful optimization, with induction typically performed at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation. For functional studies requiring properly folded membrane-associated CnrB, expression in systems that better accommodate membrane proteins, such as Lactococcus lactis or cell-free expression systems supplemented with lipid nanodiscs, may yield superior results. When designing an expression system, researchers should consider whether structural studies (requiring high purity) or functional assays (requiring proper folding and association with membrane components) are the primary objective.

What experimental approaches are most effective for studying CnrB interactions with metal ions?

Studying the interactions between CnrB and metal ions requires a multifaceted approach combining biophysical, biochemical, and genetic techniques. Isothermal titration calorimetry (ITC) provides quantitative binding parameters, including binding affinities, stoichiometry, and thermodynamic profiles of CnrB-metal interactions. X-ray absorption spectroscopy (XAS) offers detailed information about the coordination geometry and oxidation state of bound metals. For identifying specific amino acid residues involved in metal coordination, site-directed mutagenesis coupled with functional assays provides valuable insights. Researchers can introduce systematic mutations at conserved metal-binding motifs and assess the impact on resistance phenotypes in vivo or binding parameters in vitro. Additionally, fluorescence spectroscopy using intrinsic tryptophan fluorescence or extrinsic fluorophores can detect conformational changes upon metal binding. For structural studies, X-ray crystallography and cryo-electron microscopy have proven valuable in determining the three-dimensional structure of metal-binding proteins, although membrane-associated proteins like CnrB present significant challenges for crystallization.

What are the best methods for measuring CnrB-mediated metal resistance in bacterial systems?

The assessment of CnrB-mediated metal resistance requires robust quantitative methods that can accurately measure bacterial survival and growth under metal stress conditions. The most widely used approach is the minimum inhibitory concentration (MIC) determination, which identifies the lowest concentration of nickel or cobalt that inhibits visible bacterial growth. When implementing this method, researchers should establish dose-response curves across a wide concentration range (typically 0.1-10 mM for nickel and cobalt) using microdilution techniques in metal-defined media. Growth curve analysis provides more detailed information by monitoring bacterial growth kinetics in the presence of sub-lethal metal concentrations, capturing subtle resistance phenotypes that might be missed by endpoint MIC measurements. Metal accumulation assays using ICP-MS or atomic absorption spectroscopy directly quantify the effect of CnrB on cellular metal content, providing functional evidence of efflux activity. Gene expression analysis using reporter fusions (lacZ, gfp) to the cnr promoter can measure metal-dependent induction, offering insights into the regulation of the resistance system. When comparing different bacterial strains or mutants, it is essential to normalize cell densities accurately and account for potential differences in growth rates unrelated to metal resistance.

How can researchers effectively purify recombinant CnrB for structural and functional studies?

Purification of recombinant CnrB presents significant challenges due to its membrane-associated nature. An effective purification protocol typically begins with optimization of cell lysis conditions, often employing mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin to solubilize the protein without denaturation. Affinity chromatography using His-tag or other fusion tags provides an initial purification step, followed by size exclusion chromatography to achieve higher purity and assess protein aggregation. For structural studies requiring exceptionally pure protein, ion exchange chromatography may be incorporated as an additional step. Throughout the purification process, maintaining protein stability is crucial and may require the presence of glycerol (10-20%), reducing agents like DTT or β-mercaptoethanol, and specific metal ions that stabilize the native conformation. The choice of buffer components significantly impacts stability, with HEPES or Tris buffers at pH 7.5-8.0 commonly providing optimal results. Researchers should verify protein folding and function after purification using circular dichroism spectroscopy and metal-binding assays. For membrane proteins like CnrB, reconstitution into nanodiscs or liposomes following purification may be necessary to study function in a membrane-like environment.

What statistical approaches are most appropriate for analyzing metal resistance data in CnrB studies?

Experimental ApproachRecommended Statistical AnalysisMinimum ReplicationKey Considerations
Minimum Inhibitory Concentration (MIC)Mode/Median with rangen=3 biological replicatesUse two-fold dilution series
Growth Curves with Metal StressArea Under Curve (AUC) analysis with ANOVAn=5 biological replicatesInclude lag phase, exponential growth, and stationary phase
Metal Accumulation AssaysPaired t-tests or ANOVA with post-hoc testsn=4 biological replicatesNormalize to cell density or protein content
Gene Expression AnalysisNon-parametric tests (Mann-Whitney)n=3 biological, n=3 technical replicatesUse appropriate reference genes for normalization
Protein-Metal Binding AssaysNon-linear regression for Kd determinationn=3 independent protein preparationsControl for metal speciation and buffer effects

What are the most common pitfalls in experimental design when studying CnrB function?

Research on CnrB function presents several potential pitfalls that can compromise experimental outcomes if not properly addressed. One common issue is the failure to account for metal speciation and bioavailability, as culture media components can chelate metals and alter their effective concentration. Researchers should use chemically defined media when possible and consider metal speciation software to predict the actual bioavailable metal concentration. Another frequent problem is inadequate control for the expression level of recombinant CnrB, as both under- and over-expression can lead to misleading phenotypes. Western blotting or other quantitative protein measurements should verify expression levels. Cross-contamination with other metals can confound results, particularly when testing specificity; therefore, high-purity metal salts and metal-free water should be used for preparing solutions. The complexity of metal resistance systems often leads researchers to oversimplify by focusing solely on CnrB without considering its interactions with CnrA and CnrC components. Studying the complete CnrCBA system provides more physiologically relevant results. Adaptive responses during experimental timeframes can also skew results, as bacteria may upregulate alternative resistance systems during exposure; time-course experiments with appropriate controls can help identify such adaptations. Lastly, many researchers fail to distinguish between metal resistance (ability to grow at high concentrations) and metal tolerance (ability to survive but not grow), which represent distinct physiological states requiring different experimental approaches for accurate characterization.

How is genomic plasticity influencing the evolution of metal resistance systems in R. metallidurans?

Recent comparative genomic analyses between Ralstonia metallidurans strains reveal remarkable genomic plasticity that directly impacts the evolution of metal resistance systems. The significant differences observed between closely related strains such as C. metallidurans BS1 and CH34 demonstrate how mobile genetic elements drive the reorganization of resistance determinants . In CH34, the cnr determinant is located on the pMOL28 megaplasmid, whereas in BS1, it has been relocated to the chromid (CHR2) . This genomic reorganization appears to be mediated by prophages present in BS1 but absent in CH34, suggesting that phage-mediated horizontal gene transfer plays a crucial role in adaptive evolution under metal stress . The clustering of multiple resistance determinants (cnr, chr, czc) on the chromid in BS1 indicates selection pressure for co-regulation and co-evolution of these systems . This genomic reshuffling likely provides evolutionary advantages by facilitating coordinated expression of multiple resistance systems or by ensuring the inheritance of essential resistance genes through chromosomal rather than plasmid localization. Long-term experimental evolution studies under graduated metal stress could further elucidate the dynamics and mechanisms of these genomic rearrangements, potentially revealing predictable patterns of adaptation to multi-metal environments.

What are the emerging technologies for studying metal-protein interactions in the CnrCBA system?

Emerging technologies are revolutionizing our ability to study the complex metal-protein interactions within the CnrCBA system. Cryo-electron microscopy has emerged as a powerful tool for determining the structure of membrane protein complexes without crystallization, potentially enabling visualization of the complete CnrCBA complex in its native conformation. Single-molecule Förster resonance energy transfer (smFRET) can capture dynamic conformational changes in CnrB upon metal binding or during interaction with other components of the efflux system. Nanopore technology is being adapted to study metal transport through reconstituted efflux systems in artificial membranes, providing direct measurements of transport kinetics. Mass photometry offers a novel approach for studying the stoichiometry and assembly of the CnrCBA complex in near-native conditions. Advanced computational methods, including AlphaFold2 and RoseTTAFold, are increasingly accurate in predicting protein structures and may help model CnrB conformations and metal-binding sites when experimental structures are unavailable. Metal-specific fluorescent probes with improved sensitivity allow real-time monitoring of intracellular metal concentrations in living cells expressing the CnrCBA system. These technologies, when integrated with traditional biochemical and genetic approaches, promise to provide unprecedented insights into the molecular mechanisms of metal recognition, binding, and transport by the CnrCBA system.

How might structural knowledge of CnrB contribute to engineering metal resistance in other organisms?

Detailed structural knowledge of CnrB has significant potential for engineering enhanced metal resistance in other organisms for bioremediation or industrial applications. By identifying the critical metal-binding residues and structural motifs responsible for metal specificity in CnrB, researchers can design rational mutations to alter metal selectivity or enhance binding affinity. The membrane topology and interaction interfaces of CnrB with other components of the efflux system provide templates for engineering functional metal efflux systems in heterologous hosts. Structure-guided protein engineering could produce CnrB variants with increased stability or expression in non-native hosts, overcoming a common limitation in heterologous expression of metal resistance systems. Understanding the conformational changes triggered by metal binding may allow the development of constitutively active variants that function independently of native regulatory mechanisms. Beyond direct CnrB engineering, structural insights could guide the design of synthetic hybrid systems combining the most efficient components from different metal resistance determinants, potentially creating supercharged efflux systems with broader specificity or higher efficiency. The structural data could also inform the development of biosensors for environmental monitoring, where engineered CnrB variants coupled with reporter systems could detect specific metals with high sensitivity and selectivity.

What can be learned from comparing cnrB genetic organization across different bacterial species?

Comparative genomic analysis of cnrB organization across diverse bacterial species reveals important insights into the evolution and adaptation of metal resistance mechanisms. In Ralstonia metallidurans CH34, the cnr determinant is located on the pMOL28 megaplasmid, organized in an operon structure with regulatory and structural genes . By contrast, in Cupriavidus metallidurans BS1 (closely related to R. metallidurans), the cnr determinant has been relocated to the chromid (CHR2) . This differential localization highlights the mobility of metal resistance determinants and their ability to relocate within the genome in response to selective pressures. The genetic context surrounding cnrB also varies considerably between species, with some organisms showing clustering of multiple metal resistance determinants, suggesting co-regulation or co-transfer of these systems . Conservation analysis of the promoter regions reveals varying regulatory mechanisms, with some species maintaining the metal-responsive regulation seen in R. metallidurans while others show evidence of alternative regulatory schemes. The orientation and arrangement of genes within the cnr operon itself shows varying degrees of conservation, with the core structural genes (cnrCBA) typically maintained in the same order while regulatory elements show greater variability. This comparative approach provides a powerful tool for distinguishing the essential, conserved features of the system from species-specific adaptations, informing both evolutionary studies and biotechnological applications.

How do environmental conditions influence the expression and function of CnrB relative to other resistance systems?

The table below summarizes key differences between major metal resistance systems in Ralstonia metallidurans:

Resistance SystemPrimary Metal TargetsGenetic LocationInduction ConditionsKey ComponentsRegulatory Mechanism
CnrCBACobalt, NickelpMOL28 (CH34); Chromid (BS1)Co²⁺, Ni²⁺CnrC, CnrB, CnrACnrYXH regulatory system
CzcCBACobalt, Zinc, CadmiumpMOL30Co²⁺, Zn²⁺, Cd²⁺CzcC, CzcB, CzcACzcR/CzcS two-component system
NreBNickelChromosomeNi²⁺NreBCurrently not fully characterized
CopABCDCopperChromosome/ChromidCu²⁺CopA, CopB, CopC, CopDCopRS two-component system

What are the most promising future research directions for CnrB studies?

The study of CnrB and the CnrCBA resistance system continues to evolve, with several promising research directions emerging from current knowledge gaps. Structural biology approaches, particularly cryo-electron microscopy, hold significant potential for elucidating the complete three-dimensional structure of the assembled CnrCBA complex, providing unprecedented insights into the metal transport mechanism. Single-molecule techniques could reveal the dynamic conformational changes that occur during metal binding and transport, addressing fundamental questions about how these efflux systems function at the molecular level. Systems biology approaches integrating transcriptomics, proteomics, and metabolomics could provide a comprehensive understanding of how the CnrCBA system integrates with broader cellular processes and other metal homeostasis systems. Synthetic biology offers the opportunity to redesign CnrB with enhanced or altered properties for biotechnological applications, such as engineered bacteria for bioremediation of metal-contaminated environments. Evolutionary and comparative genomic studies across diverse metal-resistant bacteria could illuminate the adaptive paths leading to specialized resistance systems and reveal previously uncharacterized metal resistance determinants. The molecular basis of metal selectivity represents another crucial area for investigation, potentially leading to the development of systems with novel metal specificities. As metal resistance becomes increasingly relevant in both environmental management and industrial applications, these research directions promise to expand our fundamental understanding while generating practical applications for addressing metal contamination challenges.

How might CnrB research contribute to environmental bioremediation technologies?

Research on CnrB and related metal resistance proteins has significant implications for developing advanced bioremediation technologies for metal-contaminated environments. Understanding the molecular mechanisms of the CnrCBA efflux system provides the foundation for engineering enhanced bacterial strains with improved metal extraction and accumulation capabilities. These engineered microorganisms could be deployed in heavily contaminated industrial sites, mining waste areas, or water treatment systems to remove toxic metals from the environment. The knowledge of how CnrB functions within the efflux complex could guide the design of bacteria capable of selectively binding specific metals, allowing for targeted remediation approaches and potentially facilitating metal recovery for recycling purposes. The natural metal resistance capabilities of Ralstonia metallidurans could be further enhanced through directed evolution or synthetic biology approaches informed by structural studies of CnrB, potentially creating strains with unprecedented metal handling capacities. Beyond whole-cell applications, isolated or recombinant CnrB protein could be incorporated into biomaterials or biosensors for environmental monitoring and remediation. The comparative study of metal resistance systems across various bacteria provides insights into how these mechanisms have evolved in different environments, potentially revealing novel resistance strategies from extremophiles that could be harnessed for bioremediation under challenging conditions. As environmental metal contamination continues to pose significant global challenges, CnrB research represents a promising avenue for developing sustainable, biology-based solutions for environmental restoration and protection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.