Recombinant Ralstonia metallidurans Probable intracellular septation protein A (Rmet_1866)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics and Classification

Recombinant Ralstonia metallidurans Probable Intracellular Septation Protein A represents an important bacterial protein involved in cellular processes. The protein is derived from Cupriavidus metallidurans (formerly known as Ralstonia metallidurans), a gram-negative bacterium known for its exceptional heavy metal resistance capabilities. This organism has gained significant attention in microbiology and environmental science due to its ability to survive in environments with high concentrations of toxic metals.

The protein is identified by several key identifiers. Its primary gene name is Rmet_1866, with synonyms including yciB and Inner membrane-spanning protein YciB . The protein has been assigned the UniProt identification number Q1LM81, which serves as its unique identifier in protein databases and allows researchers to access standardized information about its sequence and known properties .

As a full-length protein spanning amino acids 1-179, Rmet_1866 represents the complete native sequence of this bacterial protein. The recombinant version is produced with an N-terminal histidine tag, which facilitates purification using affinity chromatography techniques without significantly altering the protein's functional properties . This common approach in protein science enables researchers to obtain relatively pure protein preparations for subsequent analyses.

Expression and Purification Methodology

The production of recombinant Rmet_1866 involves a series of carefully controlled processes to ensure both quantity and quality of the final product. The protein is expressed in Escherichia coli, a commonly used prokaryotic expression system that offers several advantages for recombinant protein production .

Expression System Considerations

The expression of membrane proteins like Rmet_1866 requires careful optimization of conditions to achieve proper folding and integration into membranes or inclusion bodies. The addition of an N-terminal histidine tag facilitates subsequent purification while minimizing interference with the protein's structure and function .

Purification Protocol

The purification of recombinant Rmet_1866 likely involves affinity chromatography utilizing the N-terminal histidine tag. This approach allows for selective binding of the tagged protein to metal-chelating resins, followed by elution with imidazole or similar compounds. To ensure the acquisition of full-length protein rather than truncated products, expression vectors with fusion tags on both ends might be employed, allowing for distinction between complete and incomplete protein products during the purification process .

Following affinity purification, additional steps such as size exclusion chromatography or ion-exchange chromatography may be implemented to achieve the high purity level (>90%) reported for the final product . The purified protein is then lyophilized to form a stable powder suitable for long-term storage and distribution.

Reconstitution Protocol

Before opening the vial containing lyophilized Rmet_1866, a brief centrifugation is recommended to ensure the contents are collected at the bottom. The protein should be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL .

To enhance stability, it is advisable to add glycerol to a final concentration of 5-50%. The standard recommendation is a 50% glycerol final concentration, which provides cryoprotection and prevents protein aggregation during freeze-thaw cycles . The reconstitution should be performed carefully to ensure complete dissolution without introducing bubbles or causing protein denaturation.

Predicted Functional Role

As a probable intracellular septation protein, Rmet_1866 likely plays a role in bacterial cell division processes. Septation refers to the formation of a septum or partition that divides a cell during cell division. In bacteria, this process involves the coordinated action of multiple proteins that form the divisome, a complex macromolecular assembly responsible for synthesizing the cell wall and membrane components at the division site.

The designation of Rmet_1866 as a "probable" intracellular septation protein indicates that its precise function has been predicted based on sequence homology or other computational approaches, but may not yet have been experimentally verified in detail. As an inner membrane-spanning protein, it likely contributes to membrane remodeling during the division process or facilitates the localization of other division proteins.

Cellular Localization and Potential Interactions

The classification of Rmet_1866 as an inner membrane-spanning protein (YciB) provides insights into its cellular localization . This localization is consistent with its potential role in septation, as the bacterial inner membrane undergoes significant reorganization during cell division. The protein may interact with other components of the cell division machinery, including cytoskeletal elements and enzymes involved in peptidoglycan synthesis.

Understanding the function of Rmet_1866 could provide valuable insights into bacterial cell division mechanisms, which remain an important area of research due to their potential as targets for antimicrobial development. The study of this protein in Ralstonia metallidurans is particularly interesting given this organism's unique ability to survive in metal-contaminated environments, raising questions about potential adaptations in its basic cellular processes.

Potential Research Applications

Recombinant Rmet_1866 protein can serve various purposes in scientific research. As a full-length protein with high purity, it provides a valuable tool for studying bacterial cell division mechanisms, particularly in metal-resistant organisms. Some potential applications include:

  1. Structural studies: The purified protein could be used for X-ray crystallography or cryo-electron microscopy to determine its three-dimensional structure, providing insights into its function.

  2. Interaction studies: Techniques such as pull-down assays, co-immunoprecipitation, or surface plasmon resonance could identify protein-protein interactions involving Rmet_1866, helping to elucidate its role in the cell division machinery.

  3. Functional assays: In vitro assays could assess potential enzymatic activities or membrane-remodeling capabilities of the protein.

  4. Antibody production: The recombinant protein could be used to generate specific antibodies for immunolocalization studies or Western blotting.

Challenges in Research

Despite the availability of recombinant Rmet_1866, research on this protein faces several challenges. As a membrane protein, it may exhibit complex behavior in solution and require specialized conditions for maintaining its native structure and function. Additionally, the study of bacterial cell division proteins often requires complementary approaches, combining in vitro biochemical assays with in vivo genetic and cell biological techniques.

The expression and purification of membrane proteins present particular challenges, including proper folding, solubility issues, and maintaining stability during purification steps . These challenges are common across the field of membrane protein research and require careful optimization of conditions.

Comparative Analysis

Understanding Rmet_1866 in the context of related proteins could provide valuable insights. While the search results don't provide direct information about homologous proteins, the YciB family likely includes members from various bacterial species. Comparative studies of these homologs could reveal conserved features important for function and species-specific adaptations.

Drawing parallels from search result , which discusses intrinsically disordered proteins (IDPs) and their role in bacterial predation, similar approaches could be applied to study Rmet_1866. For example, techniques such as NMR spectroscopy, which was used to study protein-protein interactions in the Bdellovibrio bacteriovorus system, could potentially be applied to investigate Rmet_1866 interactions with other cell division proteins.

Quality Control Measures

The high purity of recombinant Rmet_1866 (>90% as determined by SDS-PAGE) ensures its suitability for research applications . This level of purity minimizes interference from contaminants in experimental settings. Researchers using this protein should still consider performing their own quality control tests appropriate for their specific applications, which might include mass spectrometry verification, functional assays, or additional purity assessments.

Experimental Design Considerations

When designing experiments with recombinant Rmet_1866, researchers should consider several factors:

  1. Buffer compatibility: The protein is supplied in a specific buffer formulation, and changing to buffers with different compositions or pH values may affect stability and activity.

  2. Tag interference: While the N-terminal histidine tag facilitates purification, it may influence certain protein properties or interactions. Control experiments or tag removal might be necessary for some applications.

  3. Membrane protein handling: As a membrane protein, Rmet_1866 may require detergents or lipid environments to maintain its native conformation in solution.

  4. Species differences: When using this protein from Ralstonia metallidurans to study general bacterial cell division mechanisms, researchers should consider potential species-specific variations.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; Rmet_1866; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
Rmet_1866
Target Protein Sequence
MKFLFDLFPVILFFVAFKLFGIYPATAVAIGATVVQIAWVHFRHGKAEPMQWVSLAIIAV FGGATILLHNETFIKWKPTVLYWLFAVTLIGSVIGWRKNLIRAMMEKQVTLPEPMWGRLN VAWAGFFAVMGVLNLYVAYQFSTDTWVNFKLFGSMGLMLVFIVAQSIWLSRHIQETPSE
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of Rmet_1866 within Ralstonia metallidurans?

Rmet_1866 is located on the main chromosome of Ralstonia metallidurans, based on the genomic organization revealed through sequencing efforts by the Joint Genome Institute. The genome of R. metallidurans was sequenced with the first draft released in 2000, allowing for the identification and annotation of various genes, including those involved in cell division processes . The genomic context of Rmet_1866 suggests its integration within the core cellular machinery rather than being associated with the mobile genetic elements (plasmids pMOL28 and pMOL30) that often carry metal resistance determinants in this organism .

The gene is likely part of the core genome shared with related species in the Ralstonia genus, including R. eutropha and R. solanacearum, though specific comparative genomic analyses would be necessary to confirm conservation patterns across these taxonomically related bacteria .

How does Rmet_1866 potentially contribute to cell division in Ralstonia metallidurans?

As a probable intracellular septation protein, Rmet_1866 likely plays a crucial role in the formation of the septum during bacterial cell division. In most bacteria, septation involves the coordination of multiple proteins to form the divisome complex that orchestrates the synthesis of peptidoglycan at the division site and eventual cell separation.

The process typically involves:

  • Initial assembly of FtsZ protein at the division site to form the Z-ring

  • Recruitment of early divisome components including FtsA and ZipA

  • Assembly of late divisome components including septal peptidoglycan synthesis machinery

  • Coordinated constriction and peptidoglycan synthesis to form the septum

  • Final separation of daughter cells

Rmet_1866, as a probable septation protein, may function in one or more of these steps, potentially interacting with core divisome components or providing regulatory functions specific to R. metallidurans' unique physiological adaptations to metal-rich environments .

What structural domains and motifs characterize Rmet_1866?

While the search results don't provide specific structural information for Rmet_1866, predictions can be made based on characterized septation proteins in other bacterial systems. Typical features of bacterial septation proteins include:

  • Transmembrane domains that anchor the protein within the cytoplasmic membrane

  • Cytoplasmic domains that may interact with other divisome components

  • Periplasmic domains potentially involved in peptidoglycan remodeling

  • Protein-protein interaction motifs for divisome assembly

  • Potential regulatory domains that respond to environmental conditions

For Rmet_1866 specifically, structural analysis would require computational prediction tools and experimental verification through methods such as X-ray crystallography or cryo-electron microscopy. Researchers should employ tools like Pfam, InterPro, and SMART to identify conserved domains that might suggest specific functions within the cell division process.

How might metal resistance mechanisms of Ralstonia metallidurans influence the expression and function of Rmet_1866?

Ralstonia metallidurans CH34 possesses extensive metal resistance mechanisms, which may indirectly influence septation proteins like Rmet_1866. The bacterium's adaptation to metal-rich environments involves:

  • RND (resistance-nodulation-cell division) detoxification systems

  • CDF (cation diffusion facilitation) systems

  • Efflux P1-ATPases

  • Specific resistance systems for mercury, copper, chromate, and arsenic/antimony oxyanions

The functionality of Rmet_1866 might be influenced by these metal resistance mechanisms in several ways:

  • Metal-induced stress responses may alter expression patterns of cell division genes

  • Metal binding to divisome components could affect protein-protein interactions

  • Changes in membrane composition under metal stress may impact septation protein localization

  • Metal-responsive regulatory systems might directly or indirectly control septation timing

The interconnection between metal homeostasis and cell division represents an important area for investigation, particularly in understanding how Rmet_1866 functions under varying metal concentrations that R. metallidurans encounters in its natural habitats .

What expression systems are optimal for producing recombinant Rmet_1866?

When expressing recombinant Rmet_1866 for biochemical and structural studies, researchers should consider several expression systems, each with distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coli BL21(DE3)High yield, simple protocols, economicalPotential folding issues for membrane proteinsInduction: 0.1-0.5 mM IPTG, 18-25°C, 12-16 hours
E. coli C41/C43Specialized for membrane/toxic proteinsLower yield than standard strainsInduction: 0.1 mM IPTG, 20°C, 16-20 hours
Homologous expression in RalstoniaNative folding environment, appropriate post-translational modificationsComplex protocols, lower yieldInducible promoter systems specific to Ralstonia
Cell-free expressionAvoids toxicity issues, rapid productionExpensive, potentially lower yieldOptimized redox conditions for proper folding

For Rmet_1866, which likely contains transmembrane domains as a septation protein, the E. coli C41/C43 strains or homologous expression in Ralstonia would be recommended to ensure proper folding and functionality. Expression should be optimized by testing various induction conditions and the addition of specific metal ions that might stabilize the protein structure based on R. metallidurans' metal-rich native environment .

How can CRISPR-Cas9 genome editing be applied to study Rmet_1866 function in vivo?

CRISPR-Cas9 technology provides powerful approaches for studying Rmet_1866 function in its native context:

  • Gene Knockout Strategy:

    • Design sgRNAs targeting the Rmet_1866 coding sequence

    • Introduce CRISPR-Cas9 components via conjugation or electroporation

    • Select for successful editing events using appropriate markers

    • Verify knockout through sequencing and PCR validation

    • Analyze phenotypic changes in cell morphology, division timing, and metal resistance

  • Tagging Strategy for Localization Studies:

    • Design sgRNAs and repair templates to introduce fluorescent protein tags

    • Create C-terminal or N-terminal fusions while preserving protein function

    • Monitor protein localization during different growth phases and metal exposure conditions

    • Correlate localization patterns with septation events

  • Promoter Replacement for Expression Studies:

    • Replace native promoter with inducible systems to control expression levels

    • Analyze dose-dependent effects of Rmet_1866 expression on cell division

    • Identify potential threshold levels required for proper septation

When implementing CRISPR-Cas9 in R. metallidurans, researchers should be mindful of the bacterium's natural metal resistance mechanisms and adapt protocols accordingly, potentially using specific metal ions as selective agents in conjunction with antibiotic markers .

What purification protocols yield optimal results for recombinant Rmet_1866?

Purification of recombinant Rmet_1866 requires careful consideration of its predicted membrane association and potential metal-binding properties. A recommended purification workflow includes:

  • Cell Lysis and Membrane Fraction Isolation:

    • Mechanical disruption (French press or sonication) in buffer containing protease inhibitors

    • Differential centrifugation to separate membrane fraction (40,000-100,000 × g)

    • Membrane solubilization using detergents such as DDM, LDAO, or CHAPS at 1-2% concentration

  • Affinity Chromatography:

    • His-tag purification using Ni-NTA or TALON resin

    • Buffer conditions: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergent, 5-10% glycerol

    • Gradual imidazole elution (50-300 mM) to minimize co-purification of contaminating proteins

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Ion exchange chromatography based on predicted isoelectric point

  • Quality Control:

    • SDS-PAGE and western blotting to confirm purity and identity

    • Dynamic light scattering to assess homogeneity

    • Thermal shift assays to evaluate stability under various buffer conditions

When purifying Rmet_1866, researchers should consider incorporating specific metal ions (such as zinc, copper, or cadmium) that might be relevant to R. metallidurans biology, to maintain native protein structure and function .

What analytical methods can verify the structural integrity of purified Rmet_1866?

Verifying the structural integrity of purified Rmet_1866 is crucial for functional studies. Recommended analytical approaches include:

For membrane-associated proteins like Rmet_1866, special consideration should be given to maintaining a stable detergent environment throughout analysis. Additionally, incorporating metal ions relevant to R. metallidurans biology may be crucial for maintaining native structural features .

How can researchers develop functional assays to validate the septation activity of Rmet_1866?

Developing functional assays for Rmet_1866 septation activity requires approaches that link the protein to observable cell division phenotypes:

  • Complementation Assays:

    • Generate Rmet_1866 knockout strains showing division defects

    • Transform with wild-type or mutant Rmet_1866 variants

    • Quantify restoration of normal division using cell morphology analysis

    • Measure growth rates and division timing to assess functionality

  • Protein Localization Studies:

    • Create fluorescent protein fusions with Rmet_1866

    • Perform time-lapse microscopy during cell division

    • Correlate Rmet_1866 localization with septum formation

    • Co-localize with known divisome markers (FtsZ, FtsA)

  • Biochemical Interaction Studies:

    • Identify protein-protein interactions using pull-down assays

    • Perform bacterial two-hybrid screening to find divisome partners

    • Validate interactions using surface plasmon resonance or microscale thermophoresis

    • Map interaction domains through truncation analysis

  • Metal-Dependent Functionality Tests:

    • Assess Rmet_1866 activity under varying metal conditions

    • Measure septation efficiency in metal-depleted or metal-enriched media

    • Identify potential metal-binding sites through mutagenesis

    • Correlate metal binding with protein activity using isothermal titration calorimetry

These functional assays should be designed to work within the context of R. metallidurans' unique physiology, particularly its adaptation to metal-rich environments .

How does Rmet_1866 function compare with septation proteins in other metal-resistant bacteria?

Comparative analysis of Rmet_1866 with septation proteins in other metal-resistant bacteria provides insights into potential specialized adaptations:

  • Phylogenetic Analysis:

    • Identify homologs in related Ralstonia species and other metal-resistant bacteria

    • Construct phylogenetic trees to track evolutionary relationships

    • Identify conserved regions that may indicate functional importance

    • Note lineage-specific adaptations that correlate with specific metal resistance profiles

  • Structural Comparison:

    • Compare predicted secondary and tertiary structures

    • Identify conserved domains versus variable regions

    • Analyze potential metal-binding motifs unique to Rmet_1866

  • Functional Complementation:

    • Express Rmet_1866 in other bacterial species with mutations in septation genes

    • Assess ability to rescue division defects across species boundaries

    • Identify species-specific functional constraints

  • Transcriptional Response Analysis:

    • Compare expression patterns of septation genes under metal stress

    • Identify co-regulated genes that may function with Rmet_1866

    • Determine if metal-resistant species share common regulatory mechanisms

This comparative approach places Rmet_1866 within an evolutionary context and helps identify adaptations specific to R. metallidurans' unique ecological niche in metal-contaminated environments .

What role might Rmet_1866 play in R. metallidurans' adaptation to metal-rich environments?

While septation proteins primarily function in cell division, Rmet_1866 may have evolved specialized functions related to R. metallidurans' metal resistance capabilities:

  • Potential Direct Roles:

    • Coordinating cell division timing with metal stress responses

    • Facilitating proper placement of metal efflux systems during division

    • Ensuring equal distribution of metal resistance plasmids to daughter cells

    • Protecting divisome components from metal toxicity

  • Indirect Contributions:

    • Maintaining cell envelope integrity under metal stress

    • Coordinating with stress response systems during division

    • Adapting septation mechanisms to alterations in membrane composition

    • Facilitating rapid adaptation through controlled division rates

  • Experimental Approaches to Test These Hypotheses:

    • Analyze Rmet_1866 expression profiles under different metal exposures

    • Examine division defects in knockout strains grown in metal-rich media

    • Test for physical or genetic interactions with known metal resistance determinants

    • Assess metal distribution in daughter cells when Rmet_1866 is depleted

R. metallidurans' specialized adaptation to toxic environments likely involves coordination between basic cellular processes like division and metal homeostasis systems, with proteins like Rmet_1866 potentially serving as interface points between these systems .

How can site-directed mutagenesis be applied to study key residues in Rmet_1866?

Site-directed mutagenesis provides a powerful approach to dissect the structure-function relationships of Rmet_1866:

  • Target Selection Strategy:

    • Identify conserved residues through multiple sequence alignment

    • Predict functional domains using computational tools

    • Focus on potential metal-binding motifs or interaction interfaces

    • Select charged or hydrophobic residues at predicted functional sites

  • Mutagenesis Protocol:

    • Employ overlap extension PCR or commercial mutagenesis kits

    • Create alanine scanning mutants for initial functional mapping

    • Generate conservative and non-conservative substitutions at key positions

    • Develop truncation mutants to identify minimal functional domains

  • Functional Assessment:

    • Express mutant variants in Rmet_1866-knockout strains

    • Quantify complementation efficiency through growth and morphology analysis

    • Assess protein localization changes using fluorescent fusions

    • Measure biochemical activities like protein binding or ATPase activity

  • Structure-Function Analysis:

    • Correlate mutation effects with structural predictions

    • Map functional surfaces based on mutation sensitivity

    • Identify residues involved in metal coordination versus protein interactions

    • Develop a mechanistic model of Rmet_1866 function

A comprehensive mutagenesis approach would systematically target different regions of Rmet_1866 to build a detailed functional map of this probable septation protein .

How might Rmet_1866 interact with the metal resistance determinants in R. metallidurans?

R. metallidurans contains extensive metal resistance systems, primarily encoded on plasmids pMOL28 and pMOL30, as well as chromosomal loci. Potential interactions between Rmet_1866 and these systems include:

  • Spatial Coordination:

    • Co-localization of septation machinery with metal efflux systems

    • Coordinated distribution of metal resistance plasmids during division

    • Organization of the cell envelope to maintain resistance during division

  • Functional Interactions:

    • Potential direct protein-protein interactions with metal transporters

    • Co-regulation with metal resistance operons

    • Adaptation of septation timing based on metal stress levels

  • Experimental Approaches:

    • Co-immunoprecipitation to identify physical interactions

    • Synthetic genetic array analysis to find genetic interactions

    • Dual fluorescent labeling to track co-localization during division

    • Transcriptomic analysis to identify co-regulated pathways

The extensive P1-ATPases and RND systems in R. metallidurans may have evolved coordinated functions with cell division proteins to ensure survival in toxic environments. Understanding these interactions could reveal how basic cellular processes adapt to extreme conditions .

What protocols are recommended for analyzing Rmet_1866 expression under different metal exposure conditions?

To determine how metal exposure affects Rmet_1866 expression, researchers should implement the following approaches:

MethodApplicationTechnical ConsiderationsData Analysis
qRT-PCRMeasure mRNA levelsReference genes must be stable under metal exposureRelative quantification using ΔΔCt method
Western BlottingDetect protein levelsSpecific antibodies or epitope tags neededDensitometry normalized to loading controls
Fluorescent Reporter FusionReal-time expression monitoringEnsure reporter doesn't disrupt functionSingle-cell analysis for population heterogeneity
RNA-SeqGenome-wide expression contextRequires biological replicatesDifferential expression analysis with DESeq2 or edgeR
ProteomicsGlobal protein level changesSample preparation critical for membrane proteinsLabel-free quantification or SILAC approaches

When designing metal exposure experiments, researchers should:

  • Use physiologically relevant metal concentrations based on R. metallidurans' natural habitat

  • Consider multiple metals (Zn, Cd, Cu, Pb) individually and in combinations

  • Monitor expression across growth phases and stress conditions

  • Correlate expression changes with measurable phenotypes like division rate or morphology

This comprehensive expression analysis would provide insights into how Rmet_1866 responds to the metal-rich environments that R. metallidurans has adapted to colonize .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.