Recombinant Ralstonia metallidurans Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipoprotein Biosynthesis

Lgt catalyzes the transfer of diacylglyceryl groups from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins. This modification is vital for:

  • Outer membrane stability: Lipoproteins anchored via diacylglyceryl groups (e.g., Lpp, Pal) maintain membrane integrity and osmotic resistance .

  • Pathogenesis and antibiotic resistance: In Escherichia coli, Lgt inhibition disrupts outer membrane permeability, enhancing sensitivity to antibiotics .

While direct studies on Ralstonia metallidurans Lgt are sparse, its homology to E. coli Lgt (24–47% identity/similarity with Gram-negative enzymes ) suggests analogous mechanisms.

Biochemical Assays and Inhibitor Studies

Lgt activity is typically measured via release of glycerol phosphate (G1P) or glycerol-3-phosphate (G3P) during diacylglyceryl transfer. In E. coli, small-molecule inhibitors (e.g., G9066, G2824) show IC₅₀ values of 0.18–0.93 μM, demonstrating the feasibility of targeting Lgt .

InhibitorIC₅₀ (μM)Target OrganismSource
G90660.24E. coli
G28240.18E. coli
G28230.93E. coli

Genomic Context in Ralstonia metallidurans

The lgt gene (Rmet_2802) resides on the chromosome of Ralstonia metallidurans, alongside genes for heavy metal resistance and stress adaptation . The organism’s genome includes:

  • Two large plasmids (pMOL28, pMOL30): Harbor metal resistance genes, suggesting potential crosstalk between membrane stability and environmental stress responses .

  • Megareplicons: Contain genes for biosynthesis and detoxification, implicating Lgt in maintaining membrane function under toxic conditions .

Implications for Antibacterial Drug Development

Inhibiting Lgt disrupts outer membrane integrity, making it a promising target for Gram-negative pathogens. Key advantages include:

  • Broad-spectrum potential: Lgt is conserved across species, including Acinetobacter baumannii and E. coli .

  • Resistance mitigation: Unlike inhibitors of downstream enzymes (e.g., LspA), Lgt inhibitors are less susceptible to resistance via lpp deletion .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. To enhance long-term stability, we suggest adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Rmet_2802; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans)
Target Names
lgt
Target Protein Sequence
MLVHPQFDPVAIHLGPLAIRWYGLMYLAGFIMFLWFGRLRIRQPHIAARGWVARDLDDML FYGVLGVILGGRLGYVLFYKPGYYLTHPLEIFKVWEGGMAFHGGFLGVLIAMWVFAKVRR RHWMEVTDFIAPMIPCGLAAGRIGNFINGELWGRPTDLPWGMIFPQAGDNIPRHPSQLYQ FAGEGVALFIILWLFSRKPRPMGAVSGVFLIGYGAFRFLAEFAREPDNFLGLLALKLSMG QWLSLPMIVIGAVMVVWAYRRGNGATAAAR
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, initiating the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of prolipoprotein diacylglyceryl transferase in Ralstonia metallidurans?

Prolipoprotein diacylglyceryl transferase (Lgt) in Ralstonia metallidurans, similar to its homologs in other bacteria, catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins. This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the "lipobox" of prolipoproteins . This lipid modification is essential for proper anchoring of lipoproteins to the bacterial membrane, which is critical for maintaining cell envelope architecture and various cellular functions including nutrient uptake, transport, and metal resistance mechanisms that are particularly important in R. metallidurans .

Why is Lgt considered essential in most Gram-negative bacteria?

Deletion of the lgt gene is lethal to most Gram-negative bacteria because it disrupts the proper localization and function of numerous lipoproteins that are essential for bacterial survival . In Ralstonia metallidurans specifically, the disruption of lipoprotein processing would likely compromise the metal resistance mechanisms that are crucial for its survival in heavy metal-contaminated environments . Lipoproteins in R. metallidurans are involved in various cellular processes including membrane integrity, transport systems for nutrients and metals, and detoxification mechanisms that allow this bacterium to thrive in environments with high concentrations of heavy metals .

What are the optimal conditions for expressing recombinant R. metallidurans Lgt?

For optimal expression of recombinant R. metallidurans Lgt, researchers should consider the following methodological approach:

  • Expression System Selection: While E. coli is commonly used for heterologous protein expression, R. metallidurans itself can serve as an alternative expression host for proteins that are not efficiently expressed in E. coli . This orthogonal expression system may be particularly valuable for Lgt, which is an integral membrane protein.

  • Temperature and Induction Parameters: For membrane proteins like Lgt, lower induction temperatures (16-25°C) often yield better results by reducing aggregation and inclusion body formation.

  • Membrane Protein-Specific Considerations: The addition of specific detergents or lipids to the growth medium may enhance proper folding and stability of Lgt during expression.

  • Construct Design: Include an appropriate signal sequence to ensure proper membrane targeting, along with a purification tag positioned to avoid interference with protein folding or function.

  • Growth Media Optimization: R. metallidurans has specific nutritional preferences, with transporters for amino acids outnumbering sugar transporters nearly 3:1, suggesting that amino acid-rich media might support better growth and protein expression .

What purification strategies are most effective for R. metallidurans Lgt?

Purification of recombinant R. metallidurans Lgt requires strategies tailored to membrane proteins:

  • Membrane Extraction: Gently solubilize membranes using detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration to maintain protein stability.

  • Affinity Chromatography: Utilize histidine or other affinity tags for initial capture, ensuring that buffers contain appropriate detergent concentrations to prevent protein aggregation.

  • Size Exclusion Chromatography: Apply as a polishing step to remove aggregates and ensure homogeneity of the purified enzyme.

  • Detergent Exchange: Consider exchanging harsh detergents for milder ones during purification to maintain enzyme activity.

  • Stability Enhancement: Addition of phospholipids, particularly phosphatidylglycerol (the substrate for Lgt), may enhance enzyme stability during purification .

The purification protocol should be validated by SDS-PAGE, western blotting, and activity assays to confirm the identity and functionality of the purified enzyme.

How can the activity of recombinant R. metallidurans Lgt be reliably measured?

Several approaches can be employed to measure the activity of recombinant R. metallidurans Lgt:

  • In vitro Diacylglyceryl Transfer Assay: This assay measures the transfer of radiolabeled or fluorescently labeled diacylglyceryl from phosphatidylglycerol to a synthetic lipobox-containing peptide substrate.

  • GFP-Based Assay: A GFP-based in vitro assay, as mentioned for E. coli Lgt, can be adapted to correlate the activities of R. metallidurans Lgt with structural observations .

  • Complementation Assay: Testing the ability of R. metallidurans Lgt to complement an E. coli lgt knockout strain provides a functional readout of enzyme activity.

  • Mass Spectrometry: Analysis of lipidated peptide products using liquid chromatography-mass spectrometry (LC-MS) allows for detailed characterization of the enzymatic reaction.

  • Binding Studies: Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can be used to study the interaction between the enzyme and its substrate or inhibitors.

The choice of assay should be based on the specific research question and available equipment. Multiple assays should be used for comprehensive characterization.

What key residues are critical for R. metallidurans Lgt catalytic activity?

Based on structural and functional studies of E. coli Lgt, several key residues are likely critical for R. metallidurans Lgt catalytic activity:

  • Arginine Residues: Arg143 and Arg239 have been identified as essential for diacylglyceryl transfer in E. coli Lgt through complementation studies with mutant variants . Homologous residues in R. metallidurans Lgt would likely serve similar critical functions.

  • Conserved Cysteine: Mutation in the conserved cysteine residue in the NEL domain of E. coli Lgt completely abolished E3 ubiquitin ligase activity in vitro . A corresponding cysteine residue would be expected to be essential in R. metallidurans Lgt.

  • Substrate Binding Site Residues: Residues involved in binding phosphatidylglycerol and the lipobox-containing peptide would be crucial for proper substrate positioning and catalysis.

Researchers investigating R. metallidurans Lgt should consider conducting site-directed mutagenesis of these predicted critical residues, followed by activity assays to confirm their importance in the catalytic mechanism.

How do metal ions influence the structure and function of R. metallidurans Lgt?

The influence of metal ions on R. metallidurans Lgt is a particularly relevant research question given the bacterium's remarkable metal resistance properties:

  • Metal-Binding Potential: R. metallidurans is adapted to environments with high metal content, and its proteins may have evolved specific metal-binding properties . Structural analysis should investigate whether R. metallidurans Lgt contains metal-binding motifs that could influence its stability or activity.

  • Metal-Dependent Activity Modulation: Activity assays in the presence of various metal ions (e.g., Zn²⁺, Cu²⁺, Ni²⁺, Co²⁺) would reveal whether R. metallidurans Lgt function is enhanced or inhibited by specific metals.

  • Conformational Changes: Circular dichroism (CD) spectroscopy or hydrogen-deuterium exchange mass spectrometry (HDX-MS) could detect metal-induced conformational changes in the enzyme.

  • Metal Transport Interaction: Given that 32% of transporters in R. metallidurans function in inorganic ion transport, with three-quarters acting on cations , there may be interesting connections between metal transport systems and Lgt function that warrant investigation.

What structural features enable R. metallidurans Lgt to function in heavy metal-contaminated environments?

R. metallidurans' ability to thrive in environments with high heavy metal concentrations suggests that its proteins, including Lgt, may have unique structural adaptations:

  • Amino Acid Composition: Comparative sequence analysis of Lgt from R. metallidurans versus other bacteria may reveal differences in the frequency of metal-chelating amino acids (histidine, cysteine, aspartic acid, glutamic acid).

  • Structural Stability: Thermal shift assays or circular dichroism measurements in the presence of heavy metals could determine whether R. metallidurans Lgt exhibits enhanced stability under conditions that would denature homologous enzymes from other bacteria.

  • Protective Mechanisms: Investigation of potential structural features that protect catalytic residues from metal-induced oxidation or coordination would provide insights into adaptation mechanisms.

  • Membrane Environment: The lipid composition of R. metallidurans membranes may be specialized to maintain membrane protein function in the presence of heavy metals, affecting how Lgt interacts with its membrane environment.

How can R. metallidurans Lgt be employed as a tool for heterologous lipoprotein expression?

R. metallidurans Lgt could serve as a valuable tool for heterologous lipoprotein expression in the following ways:

  • Orthogonal Expression Host: R. metallidurans has been validated as an orthogonal expression host that can produce metabolites not expressed in E. coli . This suggests that R. metallidurans and its Lgt may be capable of processing certain lipoproteins that are not efficiently processed in conventional expression systems.

  • Co-expression Strategy: Recombinant R. metallidurans Lgt could be co-expressed with target lipoproteins in heterologous hosts to enhance lipoprotein processing efficiency.

  • In vitro Lipidation System: Purified R. metallidurans Lgt could be used to develop an in vitro system for post-translational lipidation of recombinant proteins, allowing for the production of lipidated proteins for structural studies or vaccine development.

  • Substrate Specificity Engineering: The substrate specificity of R. metallidurans Lgt could potentially be engineered to recognize and lipidated modified lipoboxes, expanding the toolkit for protein lipidation.

What insights does R. metallidurans Lgt provide for understanding bacterial adaptation to extreme environments?

R. metallidurans Lgt serves as a model for understanding bacterial adaptation to extreme environments in several ways:

  • Protein Stability Mechanisms: Structural and functional characterization of R. metallidurans Lgt may reveal adaptations that enhance protein stability under high metal concentrations, providing insights applicable to other membrane proteins in extremophiles.

  • Evolutionary Adaptations: Comparative genomic and structural analyses of Lgt across Ralstonia species (e.g., R. metallidurans vs. R. solanacearum) could highlight evolutionary adaptations specific to metal resistance .

  • Membrane Biology in Extreme Conditions: Understanding how R. metallidurans Lgt functions in metal-rich environments provides insights into membrane biology adaptations that maintain critical cellular processes under extreme conditions.

  • Stress Response Integration: Investigation of how Lgt activity is regulated under metal stress could reveal mechanisms by which bacteria integrate stress responses with essential cellular processes.

How does R. metallidurans Lgt interact with the unique plasmid-encoded metal resistance systems?

R. metallidurans contains two large plasmids (pMOL28 and pMOL30) bearing a variety of genes for metal resistance , raising intriguing questions about potential interactions with Lgt:

  • Lipoprotein Components of Resistance Systems: Many metal resistance systems involve membrane-associated proteins, some of which may be lipoproteins requiring Lgt for proper processing and localization.

  • Regulatory Interconnections: There may be regulatory networks that coordinate Lgt activity with the expression of plasmid-encoded metal resistance genes in response to environmental metal concentrations.

  • Evolutionary Co-adaptation: Comparative genomic analysis could reveal whether Lgt and plasmid-encoded resistance systems have co-evolved, potentially indicating functional interdependence.

  • Functional Resilience: The retention of Lgt function under conditions that activate plasmid-encoded resistance mechanisms would be essential for maintaining membrane integrity during metal stress.

What are common challenges in expressing and purifying active R. metallidurans Lgt?

Researchers working with R. metallidurans Lgt may encounter several challenges:

  • Membrane Protein Solubilization: Finding the optimal detergent and solubilization conditions that maintain both structure and activity can be challenging. Systematic screening of detergent types and concentrations is recommended.

  • Heterologous Expression Toxicity: Overexpression of membrane proteins like Lgt can be toxic to host cells. Using tightly controlled induction systems and testing various expression conditions (temperature, inducer concentration, duration) can mitigate this issue.

  • Protein Stability During Purification: R. metallidurans proteins may have evolved to function optimally in specific metal-containing environments. Consider including appropriate metal ions in purification buffers to maintain protein stability.

  • Activity Loss During Purification: The enzymatic activity of Lgt depends on proper folding and membrane environment. Including phospholipids in purification buffers, especially phosphatidylglycerol, may help maintain activity .

  • Assay Development Challenges: Developing reliable activity assays for R. metallidurans Lgt may require optimization of substrate concentrations, buffer conditions, and detection methods to account for potential metal ion effects.

How can contradictory findings in R. metallidurans Lgt research be reconciled?

When faced with contradictory findings in R. metallidurans Lgt research, consider the following methodological approaches:

  • Experimental Condition Variations: Carefully examine differences in experimental conditions, including expression systems, purification methods, and assay conditions that might explain discrepancies.

  • Metal Concentration Effects: Since R. metallidurans is adapted to high metal environments, differences in metal ion concentrations in experimental buffers could significantly impact results. Standardize metal content or systematically investigate metal effects.

  • Post-translational Modifications: Investigate whether R. metallidurans Lgt undergoes post-translational modifications that might vary between expression systems or growth conditions.

  • Strain-Specific Variations: Consider whether genetic differences between R. metallidurans strains used in different studies might contribute to functional variations in Lgt.

  • Substrate Specificity Differences: Variations in results may stem from different substrate peptides or phospholipids used in activity assays. Standardized substrates should be employed for comparative studies.

What controls are essential when studying recombinant R. metallidurans Lgt function?

Robust experimental design for R. metallidurans Lgt studies should include these essential controls:

  • Negative Enzyme Controls: Include catalytically inactive mutants (e.g., mutations in predicted critical residues like the arginine residues homologous to Arg143 and Arg239 in E. coli Lgt) .

  • Substrate Specificity Controls: Test activity with non-lipobox containing peptides to confirm substrate specificity.

  • Metal Dependence Controls: Include EDTA or other chelating agents to determine whether activity is metal-dependent, along with various metal supplementation conditions.

  • Host Background Controls: When expressing in heterologous systems, control for potential contributions from host cell enzymes by using host strains with deleted or inactive endogenous Lgt.

  • Comparative Species Controls: Include parallel experiments with well-characterized Lgt enzymes from other bacteria (e.g., E. coli) to benchmark activity and specificity parameters.

How can structural knowledge of R. metallidurans Lgt inform inhibitor design for antimicrobial development?

The structural characterization of R. metallidurans Lgt could inform antimicrobial development strategies:

  • Conserved Catalytic Features: Identification of catalytic residues conserved across bacterial species would highlight potential targets for broad-spectrum inhibitors. The critical roles of residues homologous to Arg143 and Arg239 in E. coli suggest these as starting points .

  • Species-Specific Binding Pockets: Comparative structural analysis might reveal unique features of binding pockets that could be exploited for species-selective inhibitors.

  • Structure-Guided Drug Design: Crystal structures of R. metallidurans Lgt, similar to those obtained for E. coli Lgt at 1.9 and 1.6 Å resolution , would enable structure-guided design of inhibitors that could disrupt lipoprotein processing.

  • Resistance Mechanism Insights: R. metallidurans' ability to thrive in harsh environments might involve novel mechanisms that could inform understanding of antimicrobial resistance or adaptation.

What role might R. metallidurans Lgt play in environmental bioremediation applications?

R. metallidurans' exceptional metal resistance capabilities suggest potential applications in bioremediation:

  • Engineered Biosensors: R. metallidurans Lgt-processed lipoproteins could be engineered as components of biosensors for detecting heavy metals in environmental samples.

  • Immobilized Enzyme Technology: Recombinant R. metallidurans Lgt could potentially be used to create lipidated proteins that anchor effectively to membranes or particles for environmental remediation applications.

  • Synthetic Biology Applications: Understanding the interplay between Lgt and metal resistance mechanisms could inform the design of synthetic biological systems with enhanced metal sequestration or transformation capabilities.

  • Bioremediation Strain Enhancement: Knowledge of how R. metallidurans Lgt contributes to membrane integrity under metal stress could guide genetic modifications to enhance the performance of bioremediation strains.

How does R. metallidurans Lgt function compare across different environmental conditions?

Understanding how R. metallidurans Lgt functions across different environmental conditions would provide valuable insights:

  • Temperature-Dependent Activity Profile: Characterize enzymatic activity across a range of temperatures to determine optimal conditions and thermal stability.

  • pH Response Curve: Determine how pH affects enzyme activity, which could reveal adaptations specific to R. metallidurans' preferred environmental niches.

  • Metal Concentration Effects: Systematically evaluate how varying concentrations of different metals (Cd, Zn, Co, Pb, Hg, etc.) affect enzyme activity, stability, and substrate specificity.

  • Oxidative Stress Response: Investigate how oxidative conditions, which often accompany metal stress in natural environments, affect enzyme function.

  • Comparative Environmental Adaptation: Compare the environmental response profiles of Lgt from R. metallidurans with those from bacteria adapted to different niches to identify specific adaptations.

How does R. metallidurans Lgt sequence and structure compare to Lgt in other bacteria?

A comprehensive comparative analysis would include:

SpeciesSequence Identity to R. metallidurans LgtKey Structural DifferencesSubstrate Specificity VariationsEnvironmental Adaptation Features
E. coliModerate (typically 40-60%)*Two binding sites with specific architecture Well-characterized preference for specific lipobox sequencesAdapted to intestinal/laboratory environments
Ralstonia solanacearumHigh (typically 70-90%)*Likely conserved core structure with potential variations in substrate binding regionsMay recognize plant-pathogen specific lipoproteins Adapted to plant host environments
Other metal-resistant bacteriaVariablePotential metal-binding motifsMay process lipoproteins involved in metal resistanceSimilar adaptations to metal-rich environments

*Note: Exact sequence identity percentages would require direct sequence comparison not provided in the search results

What experimental approaches are most informative for studying the metal interaction properties of R. metallidurans Lgt?

Several complementary experimental approaches would provide comprehensive insights:

  • X-ray Absorption Spectroscopy (XAS): To characterize metal binding sites and coordination geometry within the protein structure.

  • Isothermal Titration Calorimetry (ITC): For quantitative measurement of metal binding affinity and thermodynamics.

  • Activity Assays with Metal Supplementation/Chelation: Systematic evaluation of enzymatic activity in the presence of various metals and chelating agents.

  • Metal-Dependent Thermal Stability: Differential scanning fluorimetry to assess how various metals affect protein stability.

  • Crystallography with Metal Soaking: Structural determination of metal-bound enzyme states to identify binding sites.

  • Site-Directed Mutagenesis of Predicted Metal-Binding Residues: Functional characterization of mutants to confirm the role of specific residues in metal interaction.

  • Inductively Coupled Plasma Mass Spectrometry (ICP-MS): To quantify metal content of purified enzyme preparations under various conditions.

How can advanced structural biology techniques be applied to study R. metallidurans Lgt?

Advanced structural biology approaches offer powerful tools for investigating R. metallidurans Lgt:

  • Cryo-Electron Microscopy (Cryo-EM): Particularly valuable for membrane proteins like Lgt that may be difficult to crystallize, potentially allowing visualization of the enzyme in a more native-like lipid environment.

  • Molecular Dynamics Simulations: To model the dynamic behavior of R. metallidurans Lgt within a membrane environment and predict effects of metal binding or substrate interactions.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map conformational changes upon substrate or metal binding, providing insights into the catalytic mechanism.

  • Native Mass Spectrometry: To study the intact enzyme-substrate complex and identify potential cofactors or bound metals.

  • Solid-State NMR: To study the enzyme in a membrane-like environment, providing information about dynamics and interactions not captured by static crystal structures.

  • Small-Angle X-ray Scattering (SAXS): For low-resolution structural information that can complement high-resolution techniques and provide insights into enzyme flexibility.

  • Cross-Linking Mass Spectrometry (XL-MS): To map proximity relationships between amino acids, helping to validate structural models and identify binding interfaces.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.