Recombinant Ralstonia pickettii ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ftsH; Rpic_1702; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-714
Protein Length
full length protein
Species
Ralstonia pickettii (strain 12J)
Target Names
ftsH
Target Protein Sequence
MEKPRRLRPRARPQCRGLMKVNLGDFQASILGTHTNARLSGAYPGRPPTFPALETRLTFN KVDLEKNPMEPRQQQFSLWYVLVTILAMLAIQTLFVSGHVETIPYSDFKVLLKAGKLKDV AIGEQAISGTFSTEGIDNLLAKQQIEEIRREAKGDHAFSTLRVADPELVQELEAAKVRFV GQPDNKWLSTILSWVVPAVIFFGIWSFLIKRVGGAAGSMMEIGKSKAKVYMQKETGVTFA DVAGIDEAKEELSEIVSFLKDPQRYQRLGGKIPKGVLLVGAPGTGKTLLAKAVAGEAGVP FFSMSGSDFVEMFVGVGAARVRDLFKQAETKAPCIIFIDELDALGKTRALNAVGGNEERE QTLNQLLVEMDGFDSNKGVIIMAATNRPEILDPALLRPGRFDRHVALDRPDLKGREQILK VHVKGVVLAPEVDLTKLAGRTPGFAGADLANLVNEAALLAARKSKQMVEMADFDEALDRI VGGLEKKNRVMNPKEKETIAFHEAGHAIVAEHRPLADRVSKVSIIPRGVAALGYTQQTPT EDRYLLKRSELLDRLDVLLGGRIAEQLIFGDVSTGAQNDLQRATDMARQMITQFGMSDQL GLATYENMPNPLFAGTGLMQRERNEYSESTAQMIDAEVRKLLAEASHRVQATLEGQRTKL DALAQLLLEKEVVDRQDLDMFLSAKVTPMPPPKPVANIEESTATGKPDQKTQGT
Uniprot No.

Target Background

Function

This recombinant Ralstonia pickettii ATP-dependent zinc metalloprotease FtsH (ftsH) functions as a processive, ATP-dependent zinc metallopeptidase, targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.

Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is the ATP-dependent zinc metalloprotease FtsH in Ralstonia pickettii?

The FtsH protein in Ralstonia pickettii is a membrane-bound ATP-dependent zinc metalloprotease that belongs to the AAA+ (ATPases Associated with diverse cellular Activities) protein family. This enzyme plays critical roles in protein quality control, degradation of misfolded membrane proteins, and regulation of stress responses. Like other bacterial FtsH proteins, R. pickettii FtsH likely contains an N-terminal transmembrane domain, an ATPase domain, and a proteolytic domain with a zinc-binding motif HEXXH . The protein functions by using ATP hydrolysis to unfold substrate proteins and subsequently degrades them through its proteolytic activity.

How does R. pickettii FtsH differ from other bacterial metalloproteases?

While R. pickettii FtsH shares core functional domains with other bacterial FtsH proteins, it exhibits specific adaptations that may contribute to the organism's survival in diverse environments. Unlike the extracellular metalloprotease RpA (which belongs to the serralysin family and contributes to R. pickettii cytotoxicity), FtsH is membrane-bound and primarily involved in intracellular proteolysis . Genomic analysis of R. pickettii has revealed unique mutations in key genes affecting various physiological functions including metabolism, which may extend to modifications in its proteolytic systems . These adaptations could potentially contribute to R. pickettii's remarkable environmental persistence, including its ability to survive in drinking water systems and clinical environments.

How is the ftsH gene organized in the R. pickettii genome?

The ftsH gene in R. pickettii is part of the bacterium's core genome, which comprises approximately 35.1% of its total gene content . Comprehensive genomic analysis of R. pickettii has revealed a significant open pan-genome with remarkable genetic plasticity, which may influence the genomic context of ftsH. The gene likely contains conserved domains typical of FtsH metalloproteases, including ATPase and proteolytic domains. While the specific organization of the ftsH gene in R. pickettii requires further characterization, genomic studies indicate extensive genomic rearrangements and horizontal gene transfer events have shaped the R. pickettii genome, potentially affecting the regulation and expression of genes including ftsH .

What are the optimal expression systems for producing recombinant R. pickettii FtsH?

The optimal expression system for recombinant R. pickettii FtsH production should address several key challenges:

  • E. coli-based expression systems: These represent the most commonly used platforms, with BL21(DE3) or C41/C43(DE3) strains being particularly suitable for membrane proteins. For R. pickettii FtsH, an approach similar to that used for RpA protease expression might be applicable, where an E. coli pET expression vector was successfully employed to produce a 55 kDa protease .

  • Expression vector considerations: Vectors containing inducible promoters (T7, tac, or arabinose-inducible) allow controlled expression. For R. pickettii FtsH, incorporating affinity tags (His6, Strep-tag II) at either the N- or C-terminus facilitates purification while preserving enzyme activity.

  • Solubility enhancement strategies: Given FtsH's membrane-bound nature, expression as a truncated protein lacking transmembrane domains or fusion with solubility-enhancing partners (MBP, SUMO, or Thioredoxin) may improve soluble yields.

  • Membrane protein-specific systems: For full-length FtsH including transmembrane domains, specialized expression systems like Lemo21(DE3) or membrane-specific vectors may provide superior results.

The selection of an expression system should be guided by the specific experimental goals and whether native conformation including membrane association is required.

How can researchers assess the enzymatic activity of recombinant R. pickettii FtsH in vitro?

Assessment of recombinant R. pickettii FtsH enzymatic activity requires multi-faceted approaches:

  • ATPase activity assays: Measuring ATP hydrolysis through phosphate release using malachite green or coupled enzyme assays provides insight into the enzyme's ability to utilize ATP.

  • Proteolytic activity assays:

    • Fluorogenic peptide substrates containing appropriate cleavage sites with quencher-fluorophore pairs

    • Model substrate degradation assays using known FtsH substrates (e.g., σ32, LpxC, YccA)

    • SDS-PAGE analysis of time-dependent substrate degradation

    • Zymography using casein or gelatin-containing gels

  • Inhibition studies: Testing sensitivity to protease inhibitors (especially zinc chelators like EDTA or 1,10-phenanthroline) and ATP analogs helps characterize the enzyme's catalytic mechanism.

  • Thermal stability and pH optimum determination: Assessing activity across temperature and pH ranges identifies optimal conditions and provides insights into environmental adaptations of R. pickettii FtsH.

Activity assays should incorporate appropriate controls to distinguish FtsH activity from potential contaminating proteases, particularly when using heterologous expression systems .

What structural features distinguish R. pickettii FtsH from homologs in other bacterial species?

While specific structural information about R. pickettii FtsH remains limited, comparative genomic analysis suggests potential distinguishing features:

Homology modeling based on closely related FtsH structures, combined with molecular dynamics simulations, could provide valuable insights into these structural distinctions pending experimental determination through X-ray crystallography or cryo-EM approaches.

How does FtsH contribute to R. pickettii's remarkable environmental persistence?

FtsH likely plays crucial roles in R. pickettii's well-documented environmental persistence:

  • Stress response regulation: FtsH regulates stress response factors through selective proteolysis, potentially contributing to R. pickettii's ability to withstand harsh conditions in drinking water systems .

  • Membrane integrity maintenance: By degrading misfolded or damaged membrane proteins, FtsH helps maintain membrane function under stress conditions, potentially contributing to R. pickettii's ability to survive water treatment processes.

  • Metabolic adaptation: Genomic analysis indicates adaptive mutations in R. pickettii affecting carbon and energy metabolism . FtsH may regulate key metabolic enzymes, facilitating shifts between metabolic pathways as environmental conditions change.

  • Biofilm formation support: R. pickettii forms biofilms in water systems, and FtsH may contribute to this process by regulating membrane proteins involved in attachment and biofilm development.

The genetic diversity observed in R. pickettii populations from different environments suggests that strains may possess variations in regulatory or proteolytic systems, including FtsH, that are specifically adapted to their ecological niches .

What are the most effective approaches for generating knockouts or mutants of the ftsH gene in R. pickettii?

Creating ftsH mutants in R. pickettii presents specific challenges that can be addressed through several strategic approaches:

  • Homologous recombination-based methods:

    • Suicide vector systems carrying ftsH fragments with internal deletions or insertions

    • Integration of antibiotic resistance cassettes to disrupt the ftsH gene

    • Counter-selection markers (such as sacB) to facilitate double crossover events

  • CRISPR-Cas9 gene editing:

    • Design of sgRNAs targeting conserved regions of the ftsH gene

    • Delivery of CRISPR components via conjugation or electroporation

    • Template-directed repair to introduce specific mutations in functional domains

  • Transposon mutagenesis:

    • Random mutagenesis followed by screening for insertions in ftsH

    • Mini-Tn5 transposition systems similar to those used previously in R. pickettii

    • Conditional approaches if ftsH proves essential

  • Inducible antisense RNA or CRISPRi approaches:

    • For modulation of ftsH expression without complete inactivation

    • Particularly valuable if ftsH is essential for viability

Since FtsH is often essential for bacterial viability, conditional mutation systems or partial inhibition approaches may be necessary. Researchers should verify mutants through PCR, sequencing, and complementation studies to confirm phenotypes are specifically due to ftsH disruption rather than polar effects or secondary mutations.

How can researchers characterize R. pickettii FtsH substrates and interaction partners?

Identifying the substrates and interaction partners of R. pickettii FtsH requires multi-faceted approaches:

  • Proteomics-based identification of substrates:

    • Comparative proteomics of wild-type vs. FtsH-depleted strains

    • Stable isotope labeling (SILAC) to track protein turnover rates

    • Pulse-chase experiments combined with immunoprecipitation

    • Trapped intermediates using inactive FtsH variants (e.g., mutations in the HEXXH motif)

  • Protein-protein interaction studies:

    • Co-immunoprecipitation using tagged FtsH versions

    • Bacterial two-hybrid or split-ubiquitin assays

    • Crosslinking combined with mass spectrometry (XL-MS)

    • Proximity labeling approaches (e.g., BioID, APEX)

  • In vitro degradation assays:

    • Purified candidate substrates incubated with recombinant FtsH

    • Time-course analysis of degradation patterns

    • Competition assays to determine substrate preferences

  • Bioinformatic prediction of recognition motifs:

    • Analysis of known FtsH substrates for common sequence features

    • Comparison with FtsH recognition motifs from related bacteria

    • Machine learning approaches to identify potential recognition elements

These approaches should be complemented with validation experiments, such as site-directed mutagenesis of predicted recognition motifs and in vivo stability assays of candidate substrates in wild-type versus FtsH-deficient backgrounds.

What purification strategies yield the highest activity for recombinant R. pickettii FtsH?

Purification of active recombinant R. pickettii FtsH requires strategies addressing its membrane-associated nature:

  • Membrane extraction approaches:

    • Detergent solubilization optimization (mild detergents like DDM, LMNG, or digitonin)

    • Evaluation of detergent:protein ratios to maintain native structure

    • Amphipol or nanodisc reconstitution for enhanced stability

  • Affinity chromatography strategies:

    • IMAC purification using engineered His-tags

    • Tandem affinity purification for higher purity

    • On-column detergent exchange during purification

  • Size exclusion chromatography:

    • Separation of properly assembled hexameric complexes

    • Detection of aggregation or dissociation

    • Buffer optimization to maintain oligomeric state

  • Activity preservation considerations:

    • Inclusion of zinc in purification buffers (typically 10-50 μM ZnCl₂)

    • ATP or non-hydrolyzable analogs to stabilize conformation

    • Glycerol (10-20%) to enhance stability during storage

    • Avoiding freeze-thaw cycles that compromise activity

An approach similar to that used for the RpA metalloprotease of R. pickettii might serve as a starting point, though with modifications to address the membrane-associated nature of FtsH . Purified enzyme should be validated through activity assays, circular dichroism spectroscopy, and negative-stain electron microscopy to confirm proper folding and oligomerization.

How can structural studies of R. pickettii FtsH be approached?

Structural characterization of R. pickettii FtsH presents specific challenges that can be addressed through several complementary techniques:

Structural studies should aim to capture FtsH in different nucleotide-bound states and with model substrates to understand the conformational changes driving the catalytic cycle.

What are the most promising applications of recombinant R. pickettii FtsH in research?

Recombinant R. pickettii FtsH offers several valuable research applications:

  • Model system for studying extremophile adaptations: R. pickettii FtsH could serve as a model for understanding how essential proteolytic systems adapt to extreme environmental conditions, given the bacterium's remarkable adaptability to drinking water systems and other harsh environments .

  • Understanding bacterial persistence mechanisms: Research on R. pickettii FtsH may provide insights into bacterial persistence strategies, particularly in water systems and clinical settings where R. pickettii has been identified as a problematic contaminant.

  • Comparative studies with other bacterial FtsH proteins: Structural and functional comparisons between R. pickettii FtsH and homologs from other bacteria could reveal evolutionary adaptations in this essential proteolytic system.

  • Potential antimicrobial target exploration: Given R. pickettii's emerging recognition as an opportunistic pathogen, particularly in immunocompromised individuals , its FtsH could represent a potential target for developing selective antimicrobial strategies against this bacterium.

  • Biotechnological applications: Metalloproteases from extremophiles often possess unique stability and activity profiles that may be valuable for biotechnological applications, though more research is needed to characterize the specific properties of R. pickettii FtsH.

What challenges remain in understanding R. pickettii FtsH function and regulation?

Several significant knowledge gaps and challenges remain:

  • Limited specific studies: The current literature contains few studies specifically focused on R. pickettii FtsH, with most information being inferred from genomic analyses or studies of related proteins.

  • Regulatory network complexity: The regulatory pathways controlling ftsH expression in R. pickettii, particularly in response to environmental stresses, remain largely uncharacterized.

  • Substrate specificity determinants: The molecular basis for substrate recognition by R. pickettii FtsH and how this may differ from other bacterial FtsH proteins remains unknown.

  • Role in pathogenicity: While R. pickettii has been associated with opportunistic infections , the specific contribution of FtsH to its pathogenic potential has not been established.

  • Evolutionary adaptations: How the structure and function of R. pickettii FtsH may have adapted to the organism's environmental niche, particularly in water systems, represents an important area for future research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.