Recombinant Ralstonia pickettii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
yidC; Rpic_3757; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
full length protein
Species
Ralstonia pickettii (strain 12J)
Target Names
yidC
Target Protein Sequence
MDIKRTILWVIFSLAVVLLFDNWQRANGHQSMFFPTPQTATTTAAAPGSTPAGDVPSNAS TAAAAGSQAAPATGAASQAPASEKIVISTDLLRATIDTDGAIVTKLELLDQKDHDGNPMV LFDRSVERTYLARSGLIGGDFPNHTTVFAASPGPRDLGTGNDVSITLTADKGGAKLAKTY VFKRGSYVIDSRFDVTNDGTAPINPTLYLELARDGGAVEQSRFYSTFTGPAVYTDGDKFH KITFADIDKGKAQVPAPTNSGWVAMVQHYFASAWIPADNVKREYYVNRVDTNFYRIGIQE PLGTVAPGASVSTTARLFAGPQQARMLEAITPGLDLVKDYGWLTIVAKPLFWLLEKIHAL LGNWGWSIVALTVLIKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGDPQKMNQEMMT LYRTEKVNPLGGCLPIVIQIPVFMALYWALLSSVEMRGAPWIGWVHDLSTPDPFYILPVL MAVSMFVQTKLNPTPPDPVQAKVMMFMPIAFSVMFFFFPAGLVLYWVVNNCLSIAQQWSI NRMLGTNNKAAPAK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins within the cell membrane. It is involved in the integration of membrane proteins that utilize both Sec-dependent and Sec-independent pathways, as well as some lipoproteins. Furthermore, it facilitates the folding of multi-spanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC in Ralstonia pickettii and what are its primary functions?

YidC in Ralstonia pickettii belongs to the Oxa1 superfamily and is essential for bacterial inner membrane biogenesis. It serves dual critical functions in membrane biology :

  • As an insertase: YidC facilitates the proper insertion of smaller membrane proteins into the lipid bilayer

  • As a lipid scramblase: YidC contributes to the organization of the membrane bilayer by mediating lipid movement between membrane leaflets

YidC can function independently or in association with the Sec translocon to aid in the proper folding of multi-pass membrane proteins . It plays a particularly important role in the insertion of proteins like phage coat proteins (M13 and Pf3), ATP synthase subunit c, and various small membrane proteins including SecG .

The importance of YidC extends beyond structural roles, as it significantly influences respiratory metabolism and energy production in bacteria. YidC depletion alters the expression of numerous genes involved in intermediary metabolism, respiration, cell wall processes, and lipid metabolism .

How does the structure of YidC in R. pickettii compare to other bacterial species?

YidC proteins show structural variations across bacterial species:

Bacterial TypeTransmembrane SegmentsN-Terminal DomainExample Species
Gram-negative6 transmembrane regionsLarge periplasmic domain between TM1 and TM2R. pickettii, E. coli
Gram-positive5 transmembrane regionsShort periplasmic N-terminal tail with cleavable signal sequenceB. subtilis

In Gram-negative bacteria like R. pickettii and E. coli, YidC is typically a 61 kDa protein embedded in the inner membrane with 6 transmembrane regions and a large periplasmic domain at the N-terminus situated between the first and second transmembrane segments . Homology searches have confirmed high sequence similarity among YidC proteins of Gram-negative bacteria, which consistently exhibit the presence of 6 transmembrane regions .

In contrast, YidC homologs in Gram-positive bacteria contain only 5 transmembrane segments and feature shorter periplasmic N-terminal tails with a cleavable signal sequence . This structural divergence likely reflects differences in membrane architecture and cellular organization between these bacterial types.

What experimental methods are commonly used to study YidC localization and function?

Several complementary experimental approaches are used to study YidC localization and function:

  • Fluorescent protein tagging: YidC can be expressed as a C-terminal GFP fusion protein to visualize its cellular localization using fluorescence microscopy. This approach has confirmed the envelope localization of YidC in bacterial cells .

  • Subcellular fractionation: Differential centrifugation followed by immunoblotting with anti-YidC antibodies can determine which cellular compartment contains YidC .

  • Conditional expression systems: Tetracycline-inducible expression systems allow controlled expression of YidC, enabling researchers to study the effects of YidC depletion or overexpression .

  • In vitro translation/insertion assays: These assays use inverted membrane vesicles (INVs) to measure the insertion of YidC substrate proteins, such as Pf3 coat, M13 procoat, ATP synthase F₀c, and SecG .

  • Proximity-dependent biotin labeling (BioID): This technique has been used to identify proteins that interact with YidC in its native environment, leading to important discoveries like the YidC-YibN interaction .

  • Affinity purification-mass spectrometry: This method confirms protein-protein interactions by isolating YidC complexes from native membranes and identifying binding partners .

How does YidC contribute to R. pickettii's adaptation to extreme environments?

R. pickettii demonstrates remarkable adaptability to extreme environmental conditions, including those found in drinking water systems, and YidC likely plays a significant role in this adaptation . The adaptive capacity of R. pickettii appears to be related to several genomic features:

  • Mobile genetic elements (MGEs): R. pickettii possesses diverse MGEs that contribute to genetic diversity. On average, each R. pickettii genome contains approximately 17.3 ± 8 genomic islands (GIs), 33.4 ± 1 prophages, and 1078.3 ± 34.5 horizontally transferred genes .

  • Genome plasticity: R. pickettii has an open pan-genome with a large and flexible gene repertoire, indicating high genetic plasticity that allows for adaptation to various environments .

  • Acquisition of adaptive genes: Genomic islands and horizontal gene transfer events may facilitate the acquisition of specific adaptive genes that enable survival in extreme environments .

YidC's role as a membrane insertase is likely critical for ensuring proper membrane function under environmental stress conditions. By facilitating correct protein insertion and membrane organization, YidC helps maintain membrane integrity and functionality despite environmental challenges. Additionally, YidC's involvement in respiratory metabolism suggests it may contribute to energy production adaptation in resource-limited environments like drinking water systems.

What is the relationship between YidC function and the pathogenicity of R. pickettii?

R. pickettii has been identified as a causative agent of numerous harmful infections, including bloodstream infections in hospital settings . The relationship between YidC function and R. pickettii pathogenicity appears to involve several mechanisms:

  • Virulence factor expression: Genomic analysis of R. pickettii has revealed the presence of virulence-related elements associated with macromolecular secretion systems, virulence factors, and antimicrobial resistance, all of which contribute to its pathogenic potential . YidC may play a role in inserting proteins involved in these virulence systems into the bacterial membrane.

  • Respiratory metabolism modulation: YidC controls respiratory metabolism in bacteria, and this metabolic regulation may affect the pathogen's ability to thrive in host environments . Approximately 20% of genes controlling the enduring hypoxic response of bacteria show altered expression when YidC is depleted .

  • Environmental persistence: Despite its relatively low virulence, R. pickettii's ability to persist in hospital environments, including in water sources and disinfectants, contributes to its role in nosocomial infections . YidC's function in membrane adaptation likely supports this environmental persistence.

  • Antimicrobial resistance: The presence of resistance genes in R. pickettii genomes contributes to its clinical significance . YidC may be involved in inserting membrane proteins that contribute to antimicrobial resistance mechanisms.

While R. pickettii generally exhibits low virulence, its ability to cause serious infections, particularly in immunocompromised patients, underscores the importance of understanding YidC's role in its pathogenicity and environmental adaptation .

How do YidC-YibN interactions affect membrane protein insertion and lipid organization?

Recent research has identified YibN as a crucial interactor of YidC with significant implications for membrane biology . Their interaction affects both protein insertion and lipid organization:

  • Enhanced substrate insertion: YibN has been shown to enhance the production and membrane insertion of YidC substrates . Specifically:

    • In vivo co-expression studies demonstrate that YibN augments the production of YidC substrates including M13 and Pf3 phage coat proteins, ATP synthase subunit c, and SecG .

    • In vitro translation/insertion assays using inverted membrane vesicles (INVs) enriched for YibN show a 1.5-1.8-fold stimulation of insertion for substrates like Pf3 coat, M13 procoat H5, and F₀c .

    • YibN enhances the insertion of SecG, producing three membrane-protected fragments (MPFs) after membrane insertion and proteinase K digestion .

  • Substrate specificity: YibN's effect appears to be substrate-specific, as it does not enhance the insertion of all membrane proteins:

    • YibN does not augment the production of SecG carrying the I20E mutation in its first transmembrane segment .

    • Other small membrane proteins like YajC and YhcB, whose production is not affected by YidC depletion, are also not affected by YibN .

  • Membrane lipid alterations: YibN expression induces noticeable changes in membrane lipid production and can cause local cell surface deformation . This suggests that YibN may interfere with YidC's lipid scramblase activity, potentially by creating an imbalance in protein-protein interactions that alters YidC's ability to transport lipids between membrane leaflets .

These findings indicate that YibN functions as both a physical and functional interactor of YidC, influencing its role in membrane protein insertion and lipid organization. This interaction represents an important regulatory mechanism for membrane biogenesis in bacteria.

What experimental approaches can be used to study YidC-dependent protein insertion in vitro?

Several sophisticated experimental approaches have been developed to study YidC-dependent protein insertion in vitro:

  • Inverted membrane vesicle (INV) assays: This method uses membrane vesicles with reversed orientation to study protein insertion :

    • INVs are prepared from bacterial strains with different levels of YidC or its interacting partners.

    • In vitro translation systems are used to synthesize radiolabeled substrate proteins.

    • The synthesized proteins are incubated with the INVs to allow insertion.

    • Proteinase K digestion is used to distinguish between inserted and non-inserted proteins.

    • The resulting membrane-protected fragments (MPFs) are analyzed by gel electrophoresis and quantified to measure insertion efficiency .

  • Purified component reconstitution:

    • Purified YidC is reconstituted into liposomes of defined lipid composition.

    • Substrate proteins are synthesized in vitro and their insertion into the proteoliposomes is measured.

    • This approach allows for precise control over the system components and enables investigation of direct YidC effects without other cellular factors.

  • Comparative analysis with mutant substrates:

    • Wild-type and mutant substrate proteins (like SecG vs. SecG I20E) are compared in the same insertion assay .

    • This approach helps identify specific sequence or structural requirements for YidC-dependent insertion.

  • Crosslinking studies:

    • Chemical crosslinkers can be used to capture transient interactions between YidC and inserting substrates.

    • Photoactivatable amino acids can be incorporated into substrates at specific positions to identify contact points with YidC during the insertion process.

These experimental approaches provide complementary information about YidC-dependent insertion mechanisms and can be combined to gain comprehensive insights into this complex process.

What is the clinical significance of understanding YidC function in R. pickettii?

Understanding YidC function in R. pickettii has important clinical implications:

  • Nosocomial infection control: R. pickettii has been implicated in hospital outbreaks, particularly bloodstream infections . A documented outbreak between August and October 2019 affected 22 patients in intensive care units, highlighting the clinical relevance of this pathogen . Understanding YidC's role in R. pickettii survival and virulence could inform infection control strategies.

  • Antimicrobial resistance mechanisms: Genomic analysis of R. pickettii has identified resistance genes that contribute to antimicrobial resistance . YidC may be involved in inserting membrane proteins that participate in these resistance mechanisms. Elucidating these processes could help develop strategies to overcome resistance.

  • Virulence factor expression: R. pickettii possesses virulence-related elements associated with secretion systems and other virulence factors . YidC likely plays a role in the membrane insertion of proteins involved in these systems. Targeting YidC function could potentially attenuate virulence.

  • Persistent environmental reservoirs: R. pickettii can contaminate hospital water supplies, disinfectants, and even blood-culture bottles, creating persistent reservoirs for infection . Understanding how YidC contributes to environmental persistence could help eliminate these reservoirs.

While R. pickettii typically has low virulence, its ability to cause significant infections in vulnerable populations and its environmental persistence make it a clinically important pathogen. Research on YidC could provide new approaches to control R. pickettii in healthcare settings.

How does genetic diversity among R. pickettii strains affect YidC structure and function?

The genetic diversity of R. pickettii strains likely impacts YidC structure and function in important ways:

  • Phylogenetic grouping: Phylogenetic analysis has divided R. pickettii strains into five distinct groups, with Groups 2 and 5 predominantly associated with drinking water environments . This genetic diversity may include variations in YidC sequence, structure, and function that contribute to environmental adaptation.

  • Flexible gene repertoire: R. pickettii possesses an open pan-genome with a large and flexible gene repertoire, indicating high genetic plasticity . Among the 10,005 pan-genome gene families identified, 3,514 (35.1%) represent the core-genome, while 6,491 (64.9%) represent the accessory genome and strain-specific genes . This genetic plasticity may extend to YidC and its interacting partners.

  • Mobile genetic elements: R. pickettii genomes contain numerous mobile genetic elements (MGEs) and horizontal gene transfer (HGT) events that generate genetic diversity . On average, each genome contains approximately 17.3 ± 8 genomic islands, 33.4 ± 1 prophages, and 1078.3 ± 34.5 HGT genes . These elements could potentially introduce variations in YidC sequence or expression.

  • Environment-specific adaptations: Different R. pickettii strains show adaptations to various environments, including drinking water systems and clinical settings . These adaptations may involve YidC modifications that optimize membrane protein insertion and organization for specific environmental conditions.

The genetic diversity among R. pickettii strains suggests that YidC may show strain-specific variations that contribute to the remarkable environmental adaptability and pathogenic potential of this species. These variations could affect substrate specificity, interaction with partners like YibN, or regulatory mechanisms controlling YidC expression and function.

What are the key unanswered questions about R. pickettii YidC?

Despite significant advances in understanding YidC function, several important questions remain unanswered:

  • R. pickettii-specific adaptations: How has YidC in R. pickettii specifically adapted to facilitate survival in extreme environments compared to YidC in other species? This question addresses the unique environmental adaptability of R. pickettii.

  • Structure-function relationships: What specific structural features of R. pickettii YidC determine its substrate specificity and interaction with partners like YibN? Answering this question would require detailed structural studies of R. pickettii YidC.

  • Regulation of YidC expression: How is YidC expression regulated in R. pickettii under different environmental conditions? Understanding this regulation could provide insights into the adaptive strategies of this pathogen.

  • YidC in biofilm formation: Does YidC play a role in biofilm formation by R. pickettii? Since biofilms contribute to environmental persistence and antimicrobial resistance, this question has clinical relevance.

  • Targeting YidC for antimicrobial development: Could YidC or its interactions be targeted for the development of novel antimicrobials against R. pickettii? The essential nature of YidC makes it a potential target for therapeutic intervention.

What methodological approaches can advance our understanding of R. pickettii YidC?

Advancing our understanding of R. pickettii YidC will require sophisticated methodological approaches:

  • Cryo-EM structure determination: Determining the high-resolution structure of R. pickettii YidC using cryo-electron microscopy would provide insights into its function and interactions. This could be particularly valuable for comparing YidC structures across different bacterial species.

  • Single-molecule tracking: Using advanced microscopy techniques to track the dynamics of individual YidC molecules in living R. pickettii cells could reveal its distribution, mobility, and interactions under different conditions.

  • Systems biology approaches: Integrating transcriptomic, proteomic, and metabolomic data to create comprehensive models of YidC function in R. pickettii would help understand its role in global cellular processes.

  • CRISPR-based screening: Developing CRISPR interference or activation systems for R. pickettii would enable systematic exploration of genes affecting YidC function and provide insights into its regulatory network.

  • Environmental transcriptomics: Studying YidC expression and the expression of its substrates in R. pickettii isolated from different environmental sources would help understand how YidC contributes to environmental adaptation.

  • Comparative genomics of clinical isolates: Analyzing YidC sequences and expression in clinical isolates of R. pickettii could reveal adaptations specific to the human host environment and inform therapeutic strategies.

These methodological approaches would complement existing research and provide a more comprehensive understanding of YidC function in R. pickettii.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.